Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans carboxypeptidase A2-like


LOCUS       XM_059366341             822 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996675), mRNA.
ACCESSION   XM_059366341
VERSION     XM_059366341.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..822
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..822
                     /gene="LOC131996675"
                     /note="carboxypeptidase A2-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131996675"
     CDS             1..771
                     /gene="LOC131996675"
                     /codon_start=1
                     /product="carboxypeptidase A2-like"
                     /protein_id="XP_059222324.1"
                     /db_xref="GeneID:131996675"
                     /translation="MKQSISEDLDGNKKIWIDGGTHAREWISPATVTYIIHQLTSDWE
                     NQPDYIRNKSWYFMPMINPDGYMYSRSKNRLWRKNRNPHKTSTCVGVDLNRNFNTGWK
                     TRGSSSNPCYDTYHGPSASSEKETQAVVEFVKDINDNLEAFLTFHSYSQAFIYPFGYK
                     AAKSKHASTLQRIGNAAARLIRNKTGRTYDVGATYKILGLAGGGADDWAYEELDVKYV
                     YTVELRDRGYYGFVLPPKQIAGAALEGYIFAKEVAKEF"
ORIGIN      
        1 atgaagcaga gcatttctga agatcttgac gggaataaaa aaatctggat agatggcggc
       61 actcatgcac gagaatggat ttcaccagcc accgtcacct acatcataca ccagcttact
      121 agcgattggg aaaatcaacc cgattatata cgaaataaat cttggtattt tatgcctatg
      181 ataaatccag atggctatat gtatagtcgc agcaaaaatc gtctgtggcg taaaaatcgt
      241 aacccccaca aaacctccac gtgtgtgggt gtagatctta atcgcaattt caacactggt
      301 tggaaaacca gaggttcatc ttcgaatcct tgctatgata catatcatgg cccatctgcc
      361 agttccgaga aggagaccca agctgtggtt gaatttgtaa aagatataaa tgacaatcta
      421 gaagcattct taacctttca cagttatagt caagctttta tatatccatt tggatataaa
      481 gcggctaaga gtaaacatgc cagcactttg caaagaattg gtaatgcagc tgctcgcctt
      541 ataagaaata aaactggcag aacttatgat gttggagcta cgtataagat attgggttta
      601 gctggtggtg gtgcagatga ttgggcatat gaggagttgg atgtaaaata tgtctatacc
      661 gttgaattga gggatcgtgg atactatggc tttgttttgc ccccaaaaca aattgcagga
      721 gcagctttag aaggttatat ttttgcaaaa gaagttgcaa aagaattttg aggtgactag
      781 tattgtacat taagttattt acataagttt tattacttta aa