Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366341 822 bp mRNA linear INV 02-SEP-2023 (LOC131996675), mRNA. ACCESSION XM_059366341 VERSION XM_059366341.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..822 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..822 /gene="LOC131996675" /note="carboxypeptidase A2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131996675" CDS 1..771 /gene="LOC131996675" /codon_start=1 /product="carboxypeptidase A2-like" /protein_id="XP_059222324.1" /db_xref="GeneID:131996675" /translation="MKQSISEDLDGNKKIWIDGGTHAREWISPATVTYIIHQLTSDWE NQPDYIRNKSWYFMPMINPDGYMYSRSKNRLWRKNRNPHKTSTCVGVDLNRNFNTGWK TRGSSSNPCYDTYHGPSASSEKETQAVVEFVKDINDNLEAFLTFHSYSQAFIYPFGYK AAKSKHASTLQRIGNAAARLIRNKTGRTYDVGATYKILGLAGGGADDWAYEELDVKYV YTVELRDRGYYGFVLPPKQIAGAALEGYIFAKEVAKEF" ORIGIN 1 atgaagcaga gcatttctga agatcttgac gggaataaaa aaatctggat agatggcggc 61 actcatgcac gagaatggat ttcaccagcc accgtcacct acatcataca ccagcttact 121 agcgattggg aaaatcaacc cgattatata cgaaataaat cttggtattt tatgcctatg 181 ataaatccag atggctatat gtatagtcgc agcaaaaatc gtctgtggcg taaaaatcgt 241 aacccccaca aaacctccac gtgtgtgggt gtagatctta atcgcaattt caacactggt 301 tggaaaacca gaggttcatc ttcgaatcct tgctatgata catatcatgg cccatctgcc 361 agttccgaga aggagaccca agctgtggtt gaatttgtaa aagatataaa tgacaatcta 421 gaagcattct taacctttca cagttatagt caagctttta tatatccatt tggatataaa 481 gcggctaaga gtaaacatgc cagcactttg caaagaattg gtaatgcagc tgctcgcctt 541 ataagaaata aaactggcag aacttatgat gttggagcta cgtataagat attgggttta 601 gctggtggtg gtgcagatga ttgggcatat gaggagttgg atgtaaaata tgtctatacc 661 gttgaattga gggatcgtgg atactatggc tttgttttgc ccccaaaaca aattgcagga 721 gcagctttag aaggttatat ttttgcaaaa gaagttgcaa aagaattttg aggtgactag 781 tattgtacat taagttattt acataagttt tattacttta aa