Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans retinol dehydrogenase 13-like


LOCUS       XM_059366338             966 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085325), partial mRNA.
ACCESSION   XM_059366338
VERSION     XM_059366338.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..966
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            <1..966
                     /gene="LOC106085325"
                     /note="retinol dehydrogenase 13-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 18
                     Proteins"
                     /db_xref="GeneID:106085325"
     CDS             <1..966
                     /gene="LOC106085325"
                     /codon_start=1
                     /product="retinol dehydrogenase 13-like"
                     /protein_id="XP_059222321.1"
                     /db_xref="GeneID:106085325"
                     /translation="LLLFLVHLASLLTMCLLYKWREGPSYRKTNRIDGKVVIVTGCNT
                     GIGKEIALELAKRGGRVYMACRDEQKCEKARQELIELTGNTNVFNRTLNLASLQSVRD
                     FVAKFKEEENRLDILINNAGIMGTPYQLTEDGYEQQFAVNHLGHFLLTNLLLDMLKAS
                     APSRIVVVSSVAYRVGQIQKDDINSEKSYGFFKAYGQSKLANILFTRKLAAMLKNSND
                     KVDVNCLHPGSVQSEITRNNTFMSIVNAIGSKLVLRSTKGGAQTAIYLALDPDLEGAS
                     GGYYDNMTLTALQKKAQDDKMADWLWKKSEEMVGLKENITEKNKA"
ORIGIN      
        1 cttttactat ttttggtgca tttagcctct ttgctgacaa tgtgcctctt atacaaatgg
       61 cgcgagggtc cctcatatcg aaagaccaat cgcatagatg gtaaagtggt tatagtcacc
      121 ggctgtaata caggcatagg caaagaaata gccttggaat tggccaaaag gggaggtcga
      181 gtttatatgg cttgccgtga cgagcaaaaa tgtgaaaaag ctcgtcaaga actcatcgag
      241 ttaacgggta acacaaatgt cttcaatcgt actctaaatt tggcctcttt acagtcggtg
      301 cgtgattttg tggccaaatt caaggaggag gaaaatcgtt tggatattct tatcaataat
      361 gccggcatta tgggcactcc ctatcaatta acagaggatg gctatgagca acagtttgct
      421 gtcaatcatt tgggtcactt tctgctcact aatttactgt tggatatgct aaaggcttcg
      481 gcacccagtc gcatagtggt ggttagttca gtggcctatc gtgtgggcca aatacagaag
      541 gatgatatta acagtgagaa aagctatggc ttttttaagg cctatggtca aagtaaattg
      601 gccaatattt tatttacccg aaaattagct gcaatgctaa agaactcaaa tgacaaagtt
      661 gatgttaatt gcttacaccc gggctctgtg caaagtgaaa taactcgcaa taatacattt
      721 atgagcattg tcaatgccat aggctctaaa ttggttctgc gttcaactaa aggtggtgcc
      781 caaactgcca tatatttggc tttagatcct gatttggagg gagcatcggg aggttattat
      841 gataacatga ccttgacggc gctgcaaaag aaggcccaag atgataaaat ggctgattgg
      901 ttgtggaaaa agagtgaaga aatggtgggt ttaaaggaaa atatcacaga gaagaataaa
      961 gcgtaa