Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366337 1014 bp mRNA linear INV 02-SEP-2023 (LOC106085326), mRNA. ACCESSION XM_059366337 VERSION XM_059366337.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 10% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1014 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1014 /gene="LOC106085326" /note="retinol dehydrogenase 12-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 Proteins" /db_xref="GeneID:106085326" CDS 1..1014 /gene="LOC106085326" /codon_start=1 /product="retinol dehydrogenase 12-like" /protein_id="XP_059222320.1" /db_xref="GeneID:106085326" /translation="MGVAEVLDQTLCDYVSTLRFSALFFSILSGLCLIFTLVIFNLWK WKEGPTYEKNNRIDGKVVIVTGCNTGIGKETALELARRGARVYMACRDSQKCEEARQE IMEISGNQNVFNRTLDLSSLKSVRKFAQDFKEEEQRLDILINNAGIMATPRKLTVDGY EQQFAVNHLGHFLLTNLLLERLKAAAPSRVVVVSSWMYAIGNIQKEDINSEKSYNDFR AYSQSKLANVLFTHKLAQMLHGSGVAVNCLHPGSVQTELFRNNSFLGFFSRLGKICLR STKGGAQTSLFLALDPQMAQKTGGYYDRMTLQTVVAKARDDEMADWLWRQSAKMVGLQ EGA" ORIGIN 1 atgggagtag ctgaagtttt ggatcaaacc ctgtgcgatt atgtgtccac cttaaggttt 61 tcagctttgt tcttttccat attaagtggt ctgtgcttaa tattcacttt ggttatcttc 121 aatctgtgga aatggaaaga aggtcccaca tatgagaaaa acaatcgcat agatggcaaa 181 gtggtcatag tcaccggctg caatacaggt attggaaaag aaactgctct ggaattggct 241 agaagaggag ctcgtgttta tatggcctgt cgtgatagcc aaaaatgtga agaggctcgt 301 caggaaatca tggaaatctc aggcaatcaa aatgtcttta atcgtacgct ggatttgagt 361 tcactaaaat cggtgcgtaa atttgcccaa gacttcaagg aagaagaaca aaggctggat 421 atactcatca ataatgcagg tatcatggcc acccctcgta agctaactgt ggatggctat 481 gaacaacaat ttgctgtcaa ccatttgggt catttccttt tgaccaattt gctgttagag 541 cgattaaaag ctgctgctcc cagccgtgtt gtggtggtct cttcttggat gtatgccatt 601 gggaatatac aaaaggagga tattaacagt gaaaagagtt acaatgattt tcgagcctat 661 agccaaagca aattggccaa tgtattgttc acccataaac tggctcaaat gctccacggt 721 tctggagttg ctgtgaattg tctacatccg ggttcggtgc aaactgagtt gtttcgtaac 781 aacagttttt tgggattttt cagccgcctg ggcaagattt gtttacgctc aaccaaaggt 841 ggagcccaga cttccctatt tttggccttg gatccacaaa tggcgcagaa aactggtggc 901 tattatgatc gcatgacttt acaaacagtg gtggccaagg ctcgtgatga tgaaatggcc 961 gattggctgt ggcggcaaag tgccaagatg gtggggttgc aggaaggtgc ttag