Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans retinol dehydrogenase 12-like


LOCUS       XM_059366337            1014 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085326), mRNA.
ACCESSION   XM_059366337
VERSION     XM_059366337.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 10% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1014
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1014
                     /gene="LOC106085326"
                     /note="retinol dehydrogenase 12-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 27
                     Proteins"
                     /db_xref="GeneID:106085326"
     CDS             1..1014
                     /gene="LOC106085326"
                     /codon_start=1
                     /product="retinol dehydrogenase 12-like"
                     /protein_id="XP_059222320.1"
                     /db_xref="GeneID:106085326"
                     /translation="MGVAEVLDQTLCDYVSTLRFSALFFSILSGLCLIFTLVIFNLWK
                     WKEGPTYEKNNRIDGKVVIVTGCNTGIGKETALELARRGARVYMACRDSQKCEEARQE
                     IMEISGNQNVFNRTLDLSSLKSVRKFAQDFKEEEQRLDILINNAGIMATPRKLTVDGY
                     EQQFAVNHLGHFLLTNLLLERLKAAAPSRVVVVSSWMYAIGNIQKEDINSEKSYNDFR
                     AYSQSKLANVLFTHKLAQMLHGSGVAVNCLHPGSVQTELFRNNSFLGFFSRLGKICLR
                     STKGGAQTSLFLALDPQMAQKTGGYYDRMTLQTVVAKARDDEMADWLWRQSAKMVGLQ
                     EGA"
ORIGIN      
        1 atgggagtag ctgaagtttt ggatcaaacc ctgtgcgatt atgtgtccac cttaaggttt
       61 tcagctttgt tcttttccat attaagtggt ctgtgcttaa tattcacttt ggttatcttc
      121 aatctgtgga aatggaaaga aggtcccaca tatgagaaaa acaatcgcat agatggcaaa
      181 gtggtcatag tcaccggctg caatacaggt attggaaaag aaactgctct ggaattggct
      241 agaagaggag ctcgtgttta tatggcctgt cgtgatagcc aaaaatgtga agaggctcgt
      301 caggaaatca tggaaatctc aggcaatcaa aatgtcttta atcgtacgct ggatttgagt
      361 tcactaaaat cggtgcgtaa atttgcccaa gacttcaagg aagaagaaca aaggctggat
      421 atactcatca ataatgcagg tatcatggcc acccctcgta agctaactgt ggatggctat
      481 gaacaacaat ttgctgtcaa ccatttgggt catttccttt tgaccaattt gctgttagag
      541 cgattaaaag ctgctgctcc cagccgtgtt gtggtggtct cttcttggat gtatgccatt
      601 gggaatatac aaaaggagga tattaacagt gaaaagagtt acaatgattt tcgagcctat
      661 agccaaagca aattggccaa tgtattgttc acccataaac tggctcaaat gctccacggt
      721 tctggagttg ctgtgaattg tctacatccg ggttcggtgc aaactgagtt gtttcgtaac
      781 aacagttttt tgggattttt cagccgcctg ggcaagattt gtttacgctc aaccaaaggt
      841 ggagcccaga cttccctatt tttggccttg gatccacaaa tggcgcagaa aactggtggc
      901 tattatgatc gcatgacttt acaaacagtg gtggccaagg ctcgtgatga tgaaatggcc
      961 gattggctgt ggcggcaaag tgccaagatg gtggggttgc aggaaggtgc ttag