Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome c oxidase subunit 3-like


LOCUS       XM_059366312             796 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996664), mRNA.
ACCESSION   XM_059366312
VERSION     XM_059366312.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; corrected model.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            internal stop codons :: corrected 11 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..796
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..796
                     /gene="LOC131996664"
                     /note="cytochrome c oxidase subunit 3-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 23 Proteins"
                     /db_xref="GeneID:131996664"
     CDS             1..777
                     /gene="LOC131996664"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 11 bases at 11
                     genomic stop codons"
                     /codon_start=1
                     /transl_except=(pos:49..51,aa:OTHER)
                     /transl_except=(pos:103..105,aa:OTHER)
                     /transl_except=(pos:172..174,aa:OTHER)
                     /transl_except=(pos:175..177,aa:OTHER)
                     /transl_except=(pos:244..246,aa:OTHER)
                     /transl_except=(pos:298..300,aa:OTHER)
                     /transl_except=(pos:349..351,aa:OTHER)
                     /transl_except=(pos:439..441,aa:OTHER)
                     /transl_except=(pos:721..723,aa:OTHER)
                     /transl_except=(pos:727..729,aa:OTHER)
                     /transl_except=(pos:748..750,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: cytochrome c oxidase
                     subunit 3-like"
                     /protein_id="XP_059222295.1"
                     /db_xref="GeneID:131996664"
                     /translation="MSTHSNHPFHLVDYSPXPLTASIGAITTVAGLVKXFHQYDNSLF
                     LLGNIITILTVYQXXRDVSRESTFQGLHTLAVTTGLRXGIILFILSEVLFFVSFFXAF
                     FHRSLSPSIELGAIXPPIGITPFNPFQIPLLNTVILLTSGITVTXAHHSLIENNHSQT
                     TQGLFFTVLLGVYFTILQAYEYIEAPFTIADSVYGSTFFIATGFHGLHVLIGTTFLLV
                     CLIRHLNNHFSINHHFGFEAAAXYXHFVDIVXLFLYVSIY"
     polyA_site      796
                     /gene="LOC131996664"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgtcaactc attcaaatca cccatttcat ttagtagatt atagcccatg acctttaact
       61 gcttcaattg gtgcaataac tacagttgca ggattagtaa aatgatttca tcaatatgat
      121 aattcattat ttttattagg aaatattatt acaattttaa cagtttatca atgatgacga
      181 gatgtatcac gtgaaagtac atttcaagga cttcatactt tagctgttac tacaggatta
      241 cgatgaggaa taattttatt tattttatct gaagttttat tttttgtttc ttttttttga
      301 gctttttttc atagaagttt atccccttca attgaacttg gagcaatatg acctcctata
      361 ggaattaccc cttttaatcc ttttcaaatt cctttattaa atacagtaat tttattaact
      421 tcaggaatta cagtaacatg agctcatcat agtttaatag aaaataatca ttcacaaact
      481 actcaaggat tattttttac agtattatta ggggtatatt ttacaatact tcaagcatac
      541 gaatatattg aagctccttt tactattgct gattctgttt atgggtctac attttttata
      601 gcaacaggat ttcatggact tcatgtatta attggaacaa cttttttatt agtatgttta
      661 attcgtcact taaataatca cttttcaata aatcatcact ttggattcga agcagctgct
      721 tgatattgac attttgttga tattgtttga ttattccttt atgtatcaat ttattgatga
      781 ggaggttaat ttatta