Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366311 796 bp mRNA linear INV 02-SEP-2023 (LOC131996663), mRNA. ACCESSION XM_059366311 VERSION XM_059366311.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; corrected model. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## internal stop codons :: corrected 11 genomic stop codon ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..796 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..796 /gene="LOC131996663" /note="cytochrome c oxidase subunit 3-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins" /db_xref="GeneID:131996663" CDS 1..777 /gene="LOC131996663" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 11 bases at 11 genomic stop codons" /codon_start=1 /transl_except=(pos:49..51,aa:OTHER) /transl_except=(pos:103..105,aa:OTHER) /transl_except=(pos:172..174,aa:OTHER) /transl_except=(pos:175..177,aa:OTHER) /transl_except=(pos:244..246,aa:OTHER) /transl_except=(pos:298..300,aa:OTHER) /transl_except=(pos:349..351,aa:OTHER) /transl_except=(pos:439..441,aa:OTHER) /transl_except=(pos:721..723,aa:OTHER) /transl_except=(pos:727..729,aa:OTHER) /transl_except=(pos:748..750,aa:OTHER) /product="LOW QUALITY PROTEIN: cytochrome c oxidase subunit 3-like" /protein_id="XP_059222294.1" /db_xref="GeneID:131996663" /translation="MSTHSNHPFHLVDYSPXPLTASIGAITTVAGLVKXFHQYDNSLF LLGNIITILTVYQXXRDVSRESTFQGLHTLAVTTGLRXGIILFILSEVLFFVSFFXAF FHRSLSPSIELGAIXPPIGITPFNPFQIPLLNTVILLTSGITVTXAHHSLIENNHSQT TQGLFFTVLLGVYFTILQAYEYIEAPFTIADSVYGSTFFIATGFHGLHVLIGTTFLLV CLIRHLNNHFSINHHFGFEAAAXYXHFVDIVXLFLYVSIY" polyA_site 796 /gene="LOC131996663" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgtcaactc attcaaatca cccatttcat ttagtagatt atagcccatg acctttaact 61 gcttcaattg gtgcaataac tacagttgca ggattagtaa aatgatttca tcaatatgat 121 aattcattat ttttattagg aaatattatt acaattttaa cagtttatca atgatgacga 181 gatgtatcac gtgaaagtac atttcaagga cttcatactt tagctgttac tacaggatta 241 cgatgaggaa taattttatt tattttatct gaagttttat tttttgtttc ttttttttga 301 gctttttttc atagaagttt atccccttca attgaacttg gagcaatatg acctcctata 361 ggaattaccc cttttaatcc ttttcaaatt cctttattaa atacagtaat tttattaact 421 tcaggaatta cagtaacatg agctcatcat agtttaatag aaaataatca ttcacaaact 481 actcaaggat tattttttac agtattatta ggggtatatt ttacaatact tcaagcatac 541 gaatatattg aagctccttt tactattgct gattctgttt atgggtctac attttttata 601 gcaacaggat ttcatggact tcatgtatta attggaacaa cttttttatt agtatgttta 661 attcgtcact taaataatca cttttcaata aatcatcact ttggattcga agcagctgct 721 tgatattgac attttgttga tattgtttga ttattccttt atgtatcaat ttattgatga 781 ggaggttaat ttatta