Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366298 425 bp mRNA linear INV 02-SEP-2023 protein-like (LOC106086214), mRNA. ACCESSION XM_059366298 VERSION XM_059366298.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..425 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..425 /gene="LOC106086214" /note="sex-determining region Y protein-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106086214" CDS 31..288 /gene="LOC106086214" /codon_start=1 /product="sex-determining region Y protein-like" /protein_id="XP_059222281.1" /db_xref="GeneID:106086214" /translation="MSRNFYFNRLYRNIFNNNNHHHHQQQKQQKHSDNHQQQQQQQQQ QQQHQHMETTPQHSDQHAHIHQKHEMSSNSGNQSTNYNNHK" ORIGIN 1 aaaaatcctt cattggtaag gacaacagta atgagtagaa atttctattt caatcgtttg 61 tatagaaata tattcaataa caataaccat catcatcatc agcagcaaaa gcaacaaaag 121 cattctgata accatcaaca acaacagcag cagcagcagc aacaacaaca acatcagcat 181 atggagacca cacctcagca ttctgatcag catgcacata tacatcagaa acatgaaatg 241 agtagtaata gcggtaatca gagtactaat tacaataacc ataagtgagt gagtgtctgc 301 gggagtgtgt taattagagc catggctgaa tcaagtaaca taattgagtc gatgggtgct 361 gtaagaaata cgcagtatta tggatcttct tggctttggc agctgtagcc ataacactag 421 gtctg