Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans sex-determining region Y


LOCUS       XM_059366298             425 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC106086214), mRNA.
ACCESSION   XM_059366298
VERSION     XM_059366298.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..425
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..425
                     /gene="LOC106086214"
                     /note="sex-determining region Y protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106086214"
     CDS             31..288
                     /gene="LOC106086214"
                     /codon_start=1
                     /product="sex-determining region Y protein-like"
                     /protein_id="XP_059222281.1"
                     /db_xref="GeneID:106086214"
                     /translation="MSRNFYFNRLYRNIFNNNNHHHHQQQKQQKHSDNHQQQQQQQQQ
                     QQQHQHMETTPQHSDQHAHIHQKHEMSSNSGNQSTNYNNHK"
ORIGIN      
        1 aaaaatcctt cattggtaag gacaacagta atgagtagaa atttctattt caatcgtttg
       61 tatagaaata tattcaataa caataaccat catcatcatc agcagcaaaa gcaacaaaag
      121 cattctgata accatcaaca acaacagcag cagcagcagc aacaacaaca acatcagcat
      181 atggagacca cacctcagca ttctgatcag catgcacata tacatcagaa acatgaaatg
      241 agtagtaata gcggtaatca gagtactaat tacaataacc ataagtgagt gagtgtctgc
      301 gggagtgtgt taattagagc catggctgaa tcaagtaaca taattgagtc gatgggtgct
      361 gtaagaaata cgcagtatta tggatcttct tggctttggc agctgtagcc ataacactag
      421 gtctg