Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366294 629 bp mRNA linear INV 02-SEP-2023 (LOC131996653), mRNA. ACCESSION XM_059366294 VERSION XM_059366294.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..629 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..629 /gene="LOC131996653" /note="selenoprotein BthD-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:131996653" CDS 102..503 /gene="LOC131996653" /codon_start=1 /product="selenoprotein BthD-like" /protein_id="XP_059222277.1" /db_xref="GeneID:131996653" /translation="MPKIKSKKGRREVDWSSDVHFQKTRSIVYIEHTHECPIFAIKAE EFLKFLQSQISTRQFVLIRNGYGKIEPRPGSFEIEFSQNARTSRHNLWSGLDKGPPRR DKFPNFESLMPAIHKILKKFYPDVVQRGEDD" polyA_site 629 /gene="LOC131996653" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caccatggta gctgtaatat aaagagaaaa caaaataata aataaacaaa aattgaagta 61 ctgaacaaaa aaaaaatttc ttttaaaaaa aaatctcaaa aatgcccaaa ataaaatcca 121 agaaaggccg acgggaagtg gactggtctt cggatgtcca ttttcaaaag actcgttcca 181 ttgtctatat cgaacacacc catgaatgtc ccatattcgc cattaaagct gaggagtttc 241 ttaaatttct tcaatctcaa atatcaacaa ggcaatttgt tttaatacgc aatggctatg 301 gaaaaattga gcctcgtccg ggttcattcg aaatagagtt ttcccaaaat gctcgtacct 361 caagacataa tctatggtcc ggtttagata agggtccacc gagacgggat aagtttccca 421 attttgaaag tcttatgccg gcaatacaca aaattttaaa gaaattctat ccggatgtgg 481 tgcaaagagg cgaagatgat taatgcaaat gtggaaattt gaggttggaa tgacaatgag 541 gtcctcgcat tgttttgggt actgaacaat tttaagttga ttgttgctta taaaatcctg 601 tatatcgaat aaagacaaaa caattatta