Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans selenoprotein BthD-like


LOCUS       XM_059366294             629 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996653), mRNA.
ACCESSION   XM_059366294
VERSION     XM_059366294.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..629
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..629
                     /gene="LOC131996653"
                     /note="selenoprotein BthD-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:131996653"
     CDS             102..503
                     /gene="LOC131996653"
                     /codon_start=1
                     /product="selenoprotein BthD-like"
                     /protein_id="XP_059222277.1"
                     /db_xref="GeneID:131996653"
                     /translation="MPKIKSKKGRREVDWSSDVHFQKTRSIVYIEHTHECPIFAIKAE
                     EFLKFLQSQISTRQFVLIRNGYGKIEPRPGSFEIEFSQNARTSRHNLWSGLDKGPPRR
                     DKFPNFESLMPAIHKILKKFYPDVVQRGEDD"
     polyA_site      629
                     /gene="LOC131996653"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caccatggta gctgtaatat aaagagaaaa caaaataata aataaacaaa aattgaagta
       61 ctgaacaaaa aaaaaatttc ttttaaaaaa aaatctcaaa aatgcccaaa ataaaatcca
      121 agaaaggccg acgggaagtg gactggtctt cggatgtcca ttttcaaaag actcgttcca
      181 ttgtctatat cgaacacacc catgaatgtc ccatattcgc cattaaagct gaggagtttc
      241 ttaaatttct tcaatctcaa atatcaacaa ggcaatttgt tttaatacgc aatggctatg
      301 gaaaaattga gcctcgtccg ggttcattcg aaatagagtt ttcccaaaat gctcgtacct
      361 caagacataa tctatggtcc ggtttagata agggtccacc gagacgggat aagtttccca
      421 attttgaaag tcttatgccg gcaatacaca aaattttaaa gaaattctat ccggatgtgg
      481 tgcaaagagg cgaagatgat taatgcaaat gtggaaattt gaggttggaa tgacaatgag
      541 gtcctcgcat tgttttgggt actgaacaat tttaagttga ttgttgctta taaaatcctg
      601 tatatcgaat aaagacaaaa caattatta