Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366272 662 bp mRNA linear INV 02-SEP-2023 (LOC131996649), mRNA. ACCESSION XM_059366272 VERSION XM_059366272.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..662 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..662 /gene="LOC131996649" /note="uncharacterized LOC131996649; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996649" CDS 238..552 /gene="LOC131996649" /codon_start=1 /product="uncharacterized protein LOC131996649" /protein_id="XP_059222255.1" /db_xref="GeneID:131996649" /translation="MPTPTSGGVVLYNPDWEPSSPRRQIGDTCSSAQSPHRQETRIKK IQSDTITTDSKTKSTLDPQLQHHNNHKCGTQHTTPTNSNIANPPPVKYNVYLLQSTIL II" ORIGIN 1 gcctggggat accaacgaga gagcgcagag ggcaccgtct ggcaacaata agacttcggt 61 caaggcatgc gtcgaggagg accatgtata ccatccgggc agtggtgacc cgggatttgc 121 cgcgacgacc ctattcagat cccatcattc ccgaccccac aagcagccta agatcccttt 181 ctttggcaga tgctgaccct agaggcaacg aaccaatcga tgtagaggta ggggccgatg 241 cctacgccca cctccggagg agtggtgttg tacaacccgg attgggagcc gtcttcgccc 301 aggagacaga ttggggatac gtgttcgtcg gcccagtcac ctcacaggca agaaaccagg 361 attaaaaaga tacaaagtga cacaataaca accgactcaa aaaccaaatc tacactcgac 421 ccacaattgc aacatcacaa caaccataag tgcgggacac aacatacaac accaactaat 481 tctaatattg caaacccccc acctgttaaa tacaatgtct atctactaca atcaactata 541 ctcataattt aaattttaat ctacttacta ctgctactta aatctatgaa ttgtgctatc 601 taaacctaaa tatttgctac ttaaacacta cgatctactt ataactaatg aatttaaata 661 ac