Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996649


LOCUS       XM_059366272             662 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996649), mRNA.
ACCESSION   XM_059366272
VERSION     XM_059366272.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..662
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..662
                     /gene="LOC131996649"
                     /note="uncharacterized LOC131996649; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996649"
     CDS             238..552
                     /gene="LOC131996649"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996649"
                     /protein_id="XP_059222255.1"
                     /db_xref="GeneID:131996649"
                     /translation="MPTPTSGGVVLYNPDWEPSSPRRQIGDTCSSAQSPHRQETRIKK
                     IQSDTITTDSKTKSTLDPQLQHHNNHKCGTQHTTPTNSNIANPPPVKYNVYLLQSTIL
                     II"
ORIGIN      
        1 gcctggggat accaacgaga gagcgcagag ggcaccgtct ggcaacaata agacttcggt
       61 caaggcatgc gtcgaggagg accatgtata ccatccgggc agtggtgacc cgggatttgc
      121 cgcgacgacc ctattcagat cccatcattc ccgaccccac aagcagccta agatcccttt
      181 ctttggcaga tgctgaccct agaggcaacg aaccaatcga tgtagaggta ggggccgatg
      241 cctacgccca cctccggagg agtggtgttg tacaacccgg attgggagcc gtcttcgccc
      301 aggagacaga ttggggatac gtgttcgtcg gcccagtcac ctcacaggca agaaaccagg
      361 attaaaaaga tacaaagtga cacaataaca accgactcaa aaaccaaatc tacactcgac
      421 ccacaattgc aacatcacaa caaccataag tgcgggacac aacatacaac accaactaat
      481 tctaatattg caaacccccc acctgttaaa tacaatgtct atctactaca atcaactata
      541 ctcataattt aaattttaat ctacttacta ctgctactta aatctatgaa ttgtgctatc
      601 taaacctaaa tatttgctac ttaaacacta cgatctactt ataactaatg aatttaaata
      661 ac