Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366228 450 bp mRNA linear INV 02-SEP-2023 (LOC106094408), mRNA. ACCESSION XM_059366228 VERSION XM_059366228.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..450 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..450 /gene="LOC106094408" /note="uncharacterized LOC106094408; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094408" CDS 46..357 /gene="LOC106094408" /codon_start=1 /product="uncharacterized protein LOC106094408" /protein_id="XP_059222211.1" /db_xref="GeneID:106094408" /translation="MNRLFGVFVLIFFICVIGCQTAVISDANVPPYGNEASSRLQKRS AMPHADIPNCHALRHDGRCATQFGGIRSRGRSNAMAYKGGKTVEKKTGFWTKVGDWFK G" polyA_site 450 /gene="LOC106094408" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttagtagagc tacaaagtac atacgcatca taatcgaata atacaatgaa caggttgttt 61 ggtgttttcg ttttgatttt ctttatatgt gtcattggat gtcaaaccgc tgtcatatct 121 gatgccaatg taccacccta tggtaatgag gcatcgtcaa gattgcagaa acgatcagcg 181 atgcctcatg cggatatacc caactgtcac gctctcagac atgatggaag gtgtgcaact 241 caattcgggg gaataagaag tagaggacgc tccaatgcca tggcatacaa aggtggaaag 301 acggtagaaa agaaaactgg tttttggaca aaggttggtg actggtttaa aggataaaac 361 ttctacaaat actttatgct tttttgctgt agcaggtttc tgaaaataaa ttttatttca 421 acacaaataa aatttgatat gcttaaatta