Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094408


LOCUS       XM_059366228             450 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094408), mRNA.
ACCESSION   XM_059366228
VERSION     XM_059366228.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..450
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..450
                     /gene="LOC106094408"
                     /note="uncharacterized LOC106094408; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106094408"
     CDS             46..357
                     /gene="LOC106094408"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094408"
                     /protein_id="XP_059222211.1"
                     /db_xref="GeneID:106094408"
                     /translation="MNRLFGVFVLIFFICVIGCQTAVISDANVPPYGNEASSRLQKRS
                     AMPHADIPNCHALRHDGRCATQFGGIRSRGRSNAMAYKGGKTVEKKTGFWTKVGDWFK
                     G"
     polyA_site      450
                     /gene="LOC106094408"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttagtagagc tacaaagtac atacgcatca taatcgaata atacaatgaa caggttgttt
       61 ggtgttttcg ttttgatttt ctttatatgt gtcattggat gtcaaaccgc tgtcatatct
      121 gatgccaatg taccacccta tggtaatgag gcatcgtcaa gattgcagaa acgatcagcg
      181 atgcctcatg cggatatacc caactgtcac gctctcagac atgatggaag gtgtgcaact
      241 caattcgggg gaataagaag tagaggacgc tccaatgcca tggcatacaa aggtggaaag
      301 acggtagaaa agaaaactgg tttttggaca aaggttggtg actggtttaa aggataaaac
      361 ttctacaaat actttatgct tttttgctgt agcaggtttc tgaaaataaa ttttatttca
      421 acacaaataa aatttgatat gcttaaatta