Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366227 818 bp mRNA linear INV 02-SEP-2023 (LOC106094403), transcript variant X4, mRNA. ACCESSION XM_059366227 VERSION XM_059366227.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..818 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..818 /gene="LOC106094403" /note="uncharacterized LOC106094403; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094403" CDS 98..472 /gene="LOC106094403" /codon_start=1 /product="uncharacterized protein LOC106094403 isoform X3" /protein_id="XP_059222210.1" /db_xref="GeneID:106094403" /translation="MSHTFGIAIIVLIVTIVGYHTIICTQTHNSIDYDRRAKYSFDNP FTPSTRKPSYDDTTEKLKNGRTPKPLMAWSKKDIQTNRNENIKIPNGQTCKLYKLVFK SDQLKPDYAAKLLANCLFASAL" ORIGIN 1 ctctcgctta ttattgaaga aattgtagac agcaatgttt cattaactta gtaaagaaac 61 ccctgctgcg tataaatgtt gggcatgtaa ttggagaatg agtcacacat tcggcattgc 121 tataatcgta cttattgtta caattgtcgg ataccatact ataatctgta cacaaaccca 181 caactcaata gactatgata gaagagcgaa atattcattt gacaacccat ttacaccgtc 241 aactcgaaag ccctcttatg atgataccac tgagaaactt aaaaatggga gaacccctaa 301 accactaatg gcatggagta agaaggatat acaaaccaat agaaatgaaa atatcaaaat 361 acctaatgga cagacctgta aactctacaa attggtgttt aaatcagatc aattgaaacc 421 cgactatgct gccaaactat tagcaaactg tttattcgct tccgctttgt aatccgctat 481 attgtaatgt gttgcctgaa agtaaagaag agtcaaattt agaagaatga ttctacaatg 541 gtactacatt atgaccactt acattgagag catcgcgaaa ttcaatttca gtcaaacgtc 601 gaagacctcg gaaattacga cccaggatgc gtccaaagtc atatcgagat attgaaaatc 661 gttccgttgt agatttgact tcagaactgt cggtggtatc ttcactgctg gatttctggt 721 aaaaaaaaac gaaataaatg tttattaata agatcacttc atgaaatatt ttattagaag 781 tcaatagtga tcacttcatg aaatatttta tcagaagt