Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094403


LOCUS       XM_059366227             818 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094403), transcript variant X4, mRNA.
ACCESSION   XM_059366227
VERSION     XM_059366227.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..818
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..818
                     /gene="LOC106094403"
                     /note="uncharacterized LOC106094403; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106094403"
     CDS             98..472
                     /gene="LOC106094403"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094403 isoform X3"
                     /protein_id="XP_059222210.1"
                     /db_xref="GeneID:106094403"
                     /translation="MSHTFGIAIIVLIVTIVGYHTIICTQTHNSIDYDRRAKYSFDNP
                     FTPSTRKPSYDDTTEKLKNGRTPKPLMAWSKKDIQTNRNENIKIPNGQTCKLYKLVFK
                     SDQLKPDYAAKLLANCLFASAL"
ORIGIN      
        1 ctctcgctta ttattgaaga aattgtagac agcaatgttt cattaactta gtaaagaaac
       61 ccctgctgcg tataaatgtt gggcatgtaa ttggagaatg agtcacacat tcggcattgc
      121 tataatcgta cttattgtta caattgtcgg ataccatact ataatctgta cacaaaccca
      181 caactcaata gactatgata gaagagcgaa atattcattt gacaacccat ttacaccgtc
      241 aactcgaaag ccctcttatg atgataccac tgagaaactt aaaaatggga gaacccctaa
      301 accactaatg gcatggagta agaaggatat acaaaccaat agaaatgaaa atatcaaaat
      361 acctaatgga cagacctgta aactctacaa attggtgttt aaatcagatc aattgaaacc
      421 cgactatgct gccaaactat tagcaaactg tttattcgct tccgctttgt aatccgctat
      481 attgtaatgt gttgcctgaa agtaaagaag agtcaaattt agaagaatga ttctacaatg
      541 gtactacatt atgaccactt acattgagag catcgcgaaa ttcaatttca gtcaaacgtc
      601 gaagacctcg gaaattacga cccaggatgc gtccaaagtc atatcgagat attgaaaatc
      661 gttccgttgt agatttgact tcagaactgt cggtggtatc ttcactgctg gatttctggt
      721 aaaaaaaaac gaaataaatg tttattaata agatcacttc atgaaatatt ttattagaag
      781 tcaatagtga tcacttcatg aaatatttta tcagaagt