Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106094403


LOCUS       XM_059366225             855 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106094403), transcript variant X2, mRNA.
ACCESSION   XM_059366225
VERSION     XM_059366225.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..855
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..855
                     /gene="LOC106094403"
                     /note="uncharacterized LOC106094403; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106094403"
     CDS             97..519
                     /gene="LOC106094403"
                     /codon_start=1
                     /product="uncharacterized protein LOC106094403 isoform X1"
                     /protein_id="XP_059222208.1"
                     /db_xref="GeneID:106094403"
                     /translation="MSHTFGIAIIVLIVTIVGYHTIICTQTHNSIDYDRRAKYSFDNP
                     FTPSTRKPSYDDTTEKLKNGRTPKPLMAWSKKDIQTNRNENIKIPNGQTCKLYKLQNI
                     KIFNGQPCKFYELVFKSDQLKPDYAAKLLANCLFASAL"
ORIGIN      
        1 tctcgcttat tattgaagaa attgtagaca gcaatgtttc attaacttag taaagaaacc
       61 cctgctgcgt ataaatgttg ggcatgtaat tggagaatga gtcacacatt cggcattgct
      121 ataatcgtac ttattgttac aattgtcgga taccatacta taatctgtac acaaacccac
      181 aactcaatag actatgatag aagagcgaaa tattcatttg acaacccatt tacaccgtca
      241 actcgaaagc cctcttatga tgataccact gagaaactta aaaatgggag aacccctaaa
      301 ccactaatgg catggagtaa gaaggatata caaaccaata gaaatgaaaa tatcaaaata
      361 cctaatggac agacctgtaa actctacaaa ttgcaaaata tcaaaatatt taatggacag
      421 ccctgtaaat tctacgaatt ggtgtttaaa tcagatcaat tgaaacccga ctatgctgcc
      481 aaactattag caaactgttt attcgcttcc gctttgtaat ccgctatatt gtaatgtgtt
      541 gcctgaaagt aaagaagagt caaatttaga agaatgattc tacaatggta ctacattatg
      601 accacttaca ttgagagcat cgcgaaattc aatttcagtc aaacgtcgaa gacctcggaa
      661 attacgaccc aggatgcgtc caaagtcata tcgagatatt gaaaatcgtt ccgttgtaga
      721 tttgacttca gaactgtcgg tggtatcttc actgctggat ttctggtaaa aaaaaacgaa
      781 ataaatgttt attaataaga tcacttcatg aaatatttta ttagaagtca atagtgtccg
      841 atgtctcgcc atgta