Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366224 865 bp mRNA linear INV 02-SEP-2023 (LOC106094403), transcript variant X1, mRNA. ACCESSION XM_059366224 VERSION XM_059366224.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..865 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..865 /gene="LOC106094403" /note="uncharacterized LOC106094403; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106094403" CDS 97..519 /gene="LOC106094403" /codon_start=1 /product="uncharacterized protein LOC106094403 isoform X1" /protein_id="XP_059222207.1" /db_xref="GeneID:106094403" /translation="MSHTFGIAIIVLIVTIVGYHTIICTQTHNSIDYDRRAKYSFDNP FTPSTRKPSYDDTTEKLKNGRTPKPLMAWSKKDIQTNRNENIKIPNGQTCKLYKLQNI KIFNGQPCKFYELVFKSDQLKPDYAAKLLANCLFASAL" ORIGIN 1 tctcgcttat tattgaagaa attgtagaca gcaatgtttc attaacttag taaagaaacc 61 cctgctgcgt ataaatgttg ggcatgtaat tggagaatga gtcacacatt cggcattgct 121 ataatcgtac ttattgttac aattgtcgga taccatacta taatctgtac acaaacccac 181 aactcaatag actatgatag aagagcgaaa tattcatttg acaacccatt tacaccgtca 241 actcgaaagc cctcttatga tgataccact gagaaactta aaaatgggag aacccctaaa 301 ccactaatgg catggagtaa gaaggatata caaaccaata gaaatgaaaa tatcaaaata 361 cctaatggac agacctgtaa actctacaaa ttgcaaaata tcaaaatatt taatggacag 421 ccctgtaaat tctacgaatt ggtgtttaaa tcagatcaat tgaaacccga ctatgctgcc 481 aaactattag caaactgttt attcgcttcc gctttgtaat ccgctatatt gtaatgtgtt 541 gcctgaaagt aaagaagagt caaatttaga agaatgattc tacaatggta ctacattatg 601 accacttaca ttgagagcat cgcgaaattc aatttcagtc aaacgtcgaa gacctcggaa 661 attacgaccc aggatgcgtc caaagtcata tcgagatatt gaaaatcgtt ccgttgtaga 721 tttgacttca gaactgtcgg tggtatcttc actgctggat ttctggtaaa aaaaaacgaa 781 ataaatgttt attaataaga tcacttcatg aaatatttta ttagaagtca atagtgatca 841 cttcatgaaa tattttatca gaagt