Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366203 560 bp mRNA linear INV 02-SEP-2023 (LOC131996639), mRNA. ACCESSION XM_059366203 VERSION XM_059366203.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..560 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..560 /gene="LOC131996639" /note="unconventional myosin-XV-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996639" CDS 11..514 /gene="LOC131996639" /codon_start=1 /product="unconventional myosin-XV-like" /protein_id="XP_059222186.1" /db_xref="GeneID:131996639" /translation="MARIAALLHRAADLSHVPAMKEIKFLLPKPALSIRETRPAQWVG LVQSAWPQIANLSPGQVKAQQFLNVLSAWPLFGSSFFAVKRIWAEEGPHVDDGPMWRD LILALNRRGVLFLDPNTHVNATLAIYGGHIDKEGPFRGWCIVFGHEGGPQSDAATCHT GPNRRGS" ORIGIN 1 cgtacgcgat atggctcgca tagcggcttt attgcataga gcggctgacc taagtcatgt 61 accagcaatg aaggaaatca aatttctatt gcctaaacca gctttaagta ttagagaaac 121 acggccagcc caatgggtgg gtctagtcca atcggcttgg ccacagattg ccaatctaag 181 tcctggccag gtgaaagccc aacaattctt gaatgtgttg tcggcatggc ctttattcgg 241 tagcagtttc tttgcggtga aacgtatatg ggccgaagag ggtccacatg tcgatgacgg 301 tcccatgtgg agggatttga tattggccct caatcgtagg ggggtgttat tcttggatcc 361 caatacacat gtcaatgcaa cattggccat ttatggaggt catatcgaca aggaaggtcc 421 gttccgagga tggtgcattg tttttggaca tgaaggtgga cctcaatctg atgcagcaac 481 gtgtcatacg ggtccaaacc gaagaggctc atgagatatc gcgtttggta cgccaataca 541 taaccattgg ctcttctagg