Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans unconventional myosin-XV-like


LOCUS       XM_059366203             560 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996639), mRNA.
ACCESSION   XM_059366203
VERSION     XM_059366203.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..560
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..560
                     /gene="LOC131996639"
                     /note="unconventional myosin-XV-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996639"
     CDS             11..514
                     /gene="LOC131996639"
                     /codon_start=1
                     /product="unconventional myosin-XV-like"
                     /protein_id="XP_059222186.1"
                     /db_xref="GeneID:131996639"
                     /translation="MARIAALLHRAADLSHVPAMKEIKFLLPKPALSIRETRPAQWVG
                     LVQSAWPQIANLSPGQVKAQQFLNVLSAWPLFGSSFFAVKRIWAEEGPHVDDGPMWRD
                     LILALNRRGVLFLDPNTHVNATLAIYGGHIDKEGPFRGWCIVFGHEGGPQSDAATCHT
                     GPNRRGS"
ORIGIN      
        1 cgtacgcgat atggctcgca tagcggcttt attgcataga gcggctgacc taagtcatgt
       61 accagcaatg aaggaaatca aatttctatt gcctaaacca gctttaagta ttagagaaac
      121 acggccagcc caatgggtgg gtctagtcca atcggcttgg ccacagattg ccaatctaag
      181 tcctggccag gtgaaagccc aacaattctt gaatgtgttg tcggcatggc ctttattcgg
      241 tagcagtttc tttgcggtga aacgtatatg ggccgaagag ggtccacatg tcgatgacgg
      301 tcccatgtgg agggatttga tattggccct caatcgtagg ggggtgttat tcttggatcc
      361 caatacacat gtcaatgcaa cattggccat ttatggaggt catatcgaca aggaaggtcc
      421 gttccgagga tggtgcattg tttttggaca tgaaggtgga cctcaatctg atgcagcaac
      481 gtgtcatacg ggtccaaacc gaagaggctc atgagatatc gcgtttggta cgccaataca
      541 taaccattgg ctcttctagg