Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_059366170 787 bp mRNA linear INV 02-SEP-2023 (LOC131996633), transcript variant X1, mRNA. ACCESSION XM_059366170 VERSION XM_059366170.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..787 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..787 /gene="LOC131996633" /note="uncharacterized LOC131996633; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:131996633" CDS 263..670 /gene="LOC131996633" /codon_start=1 /product="uncharacterized protein LOC131996633" /protein_id="XP_059222153.1" /db_xref="GeneID:131996633" /translation="MCTVQMCNLFNLREENRPNFEELNVQKTHFKLYYPALKTSEQSH SRFGISIISQATAQEAHQQSIQANLSVRDLDQTSFVQTIWLVCHENFQLTIGIKKYNR SFPIEFPLRTPAANSTQHLHLGDGIEFPEHEYR" ORIGIN 1 ttgtgttcaa gcggaaagaa caaaattgtc ccgcaaactt aatcgaacag ttaaatcaag 61 aggcaatgga taatgcttta aagaaaacat attgatgttg gagaatattt caaaaaaatc 121 taaataaaat gaaaaattaa caaaaaaaaa aaaacagaat aaaaaaataa ttgtaggaag 181 aatattactg aactaaaaaa ggaaataatt atcaaaaaat taaaaaaaaa aaaattaata 241 aaataagatc tcatacatat aaatgtgtac tgttcaaatg tgtaatctct ttaatctgcg 301 agaagaaaac agaccaaatt ttgaggagct taacgtgcaa aagacccact tcaaactcta 361 ctatcctgct ctcaagacct cagaacaatc tcactctcgt tttgggatat ccatcatttc 421 ccaggcaaca gcccaagaag cccatcagca gagtattcaa gcaaatttgt cggtacgtga 481 tcttgatcaa acatcctttg tccaaaccat ctggctcgta tgccatgaaa acttccaact 541 aacgataggg ataaaaaaat acaacagaag ttttccaata gagttccccc ttcgcacgcc 601 ggctgccaac agcacccagc accttcattt aggagatggc attgaatttc ccgaacatga 661 ataccgttaa cagcaccgtc aacgttgcca taaattgaga ttgaaaatgt attccgagta 721 acacaaaacg ccacagaaat aatcacatta atgaggaata aaacatgaga atgcaaaata 781 atcctgc