Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC131996633


LOCUS       XM_059366170             787 bp    mRNA    linear   INV 02-SEP-2023
            (LOC131996633), transcript variant X1, mRNA.
ACCESSION   XM_059366170
VERSION     XM_059366170.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..787
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..787
                     /gene="LOC131996633"
                     /note="uncharacterized LOC131996633; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:131996633"
     CDS             263..670
                     /gene="LOC131996633"
                     /codon_start=1
                     /product="uncharacterized protein LOC131996633"
                     /protein_id="XP_059222153.1"
                     /db_xref="GeneID:131996633"
                     /translation="MCTVQMCNLFNLREENRPNFEELNVQKTHFKLYYPALKTSEQSH
                     SRFGISIISQATAQEAHQQSIQANLSVRDLDQTSFVQTIWLVCHENFQLTIGIKKYNR
                     SFPIEFPLRTPAANSTQHLHLGDGIEFPEHEYR"
ORIGIN      
        1 ttgtgttcaa gcggaaagaa caaaattgtc ccgcaaactt aatcgaacag ttaaatcaag
       61 aggcaatgga taatgcttta aagaaaacat attgatgttg gagaatattt caaaaaaatc
      121 taaataaaat gaaaaattaa caaaaaaaaa aaaacagaat aaaaaaataa ttgtaggaag
      181 aatattactg aactaaaaaa ggaaataatt atcaaaaaat taaaaaaaaa aaaattaata
      241 aaataagatc tcatacatat aaatgtgtac tgttcaaatg tgtaatctct ttaatctgcg
      301 agaagaaaac agaccaaatt ttgaggagct taacgtgcaa aagacccact tcaaactcta
      361 ctatcctgct ctcaagacct cagaacaatc tcactctcgt tttgggatat ccatcatttc
      421 ccaggcaaca gcccaagaag cccatcagca gagtattcaa gcaaatttgt cggtacgtga
      481 tcttgatcaa acatcctttg tccaaaccat ctggctcgta tgccatgaaa acttccaact
      541 aacgataggg ataaaaaaat acaacagaag ttttccaata gagttccccc ttcgcacgcc
      601 ggctgccaac agcacccagc accttcattt aggagatggc attgaatttc ccgaacatga
      661 ataccgttaa cagcaccgtc aacgttgcca taaattgaga ttgaaaatgt attccgagta
      721 acacaaaacg ccacagaaat aatcacatta atgaggaata aaacatgaga atgcaaaata
      781 atcctgc