Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii low-density lipoprotein


LOCUS       XM_044396282           15440 bp    mRNA    linear   INV 09-DEC-2024
            receptor-related protein megalin (mgl), transcript variant X1,
            mRNA.
ACCESSION   XM_044396282
VERSION     XM_044396282.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044396282.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..15440
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..15440
                     /gene="mgl"
                     /note="low-density lipoprotein receptor-related protein
                     megalin; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 20 Proteins"
                     /db_xref="GeneID:108054711"
     CDS             1015..15297
                     /gene="mgl"
                     /codon_start=1
                     /product="low-density lipoprotein receptor-related protein
                     2"
                     /protein_id="XP_044252217.1"
                     /db_xref="GeneID:108054711"
                     /translation="MNPTPMGIGFGFGRKPPNKARMRSRWRPPPPATTLLTPDPAEGD
                     NPAADPLQVTEASASASAPSSPIGDHRHPQLDSSRAAEPRLQHQQQEAQHYRQHRGQL
                     TTLALLLLALVALSNLETLLAVRTEGPRNRHGSPGGSLGSTGGINTECPTDSFRCNNG
                     KCISHHWVCNYQKDCDDGEDEMQSCPPPECETPQLNCGQYVFNKTYCIPPHYRCDMIE
                     DCEDKSDEAQCTYRKCQHTDVFCNAPNGAAPAEGARLAGPCVPKEKRCDGYLDCRTGK
                     DEEGCSGVSCRLDQFRCANGHKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCS
                     NALCIPYNFHCDGYHDCADKSDEANCTAIACPDNKHLCPRGGASGTPKCILKSQLCDG
                     KRDCEDGSDEETNCSIASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRTCVDLDEC
                     AEWGHCDQLCTNTLGSYTCQCAQGYTLINDSKCIAPDANNLQLIFAHDRAIMQMKPHG
                     SEPMVLANATAAAGVTFHYARNTLYWSDIKTRKVQSLPLDAQNKAVSPFDQTLPGTWA
                     PVALAVDWVGDKIYVADLVGQKIDVFELSGQWHAVVLGSNLTSPADLALDPTAGLMFV
                     ADGGQVLRAHMDGTHARSIVSEAAYKASGVTVDIIAKRVFWCDSLLDYIESVDYEGGH
                     RVMVLRGQQVPSPSRLALFENRIYWTDATKQGIMSVDKFEGPTSIQVTHKSKDIREPK
                     GIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVKGAPTGLGFRCACSTGYQLETDLKL
                     CKPVSEFLMYSQQRFIKGKVLEPVIEGFSDAIMPVVSRRARFVGLDFDARDEFIYYSD
                     VLQDVIYRVHRNGTGREIVLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVLSTRNVT
                     HRRTLLKNLKRPRAIVVHPNRGFIFFSEWDRPANITRANTDGSGLLVFKNVTLGWPNG
                     LSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPFSIVIHNDWMYITDWRL
                     DAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIAETQPCHRNNGGCQKICFA
                     VPIGGGNATTNGGTPSFGRLQSRCSCPYGERLAEDQMSCIPDPSAEPPVQPCPNSWDF
                     TCNNQRCIPKSWVCDGDDDCLDNSDEEQNCTKPTCGSNEFQCRSGRCIPQNFRCDQEN
                     DCGDNSDEQECGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEGDFCAEKTCAY
                     FQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKCADLRQCVEESYKC
                     DGIPDCNDGSDEVGCPPMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDCSDHSDEQD
                     CGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGAEHACVPPPFKCPHGQWQCP
                     GVSERCVNITSVCDDTADCPNGSDEGEGCDLAECEHQAGQCSSFCQKTPNGALCICPP
                     GSEIGEDGYTCIDTNECDPPGLCSQQCTNTKGSYFCSCQEGYILEPNKHTCKAVNHTA
                     AFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFWSDMKLKKISRLDR
                     GMEPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVLVRENITQP
                     RGMCIDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLTLDIATKRV
                     YFADSKLDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQLNRVLSANK
                     FRGKNQTVVSHLISQPLSIHVHHASLQPMTPNPCASARCQHLCLLSPSASEGYSCKCK
                     PGFKLLSEGRCIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIESSTGLDFDR
                     KGETLYWVQGREDDDENCTIYTTPYGGGNKTLFLGTESGIVGAPYTIAFDWLGRNLYI
                     GNRVASNIEAVRVDGKQKYRTIILANDGYANSVSRPKQIVLDPTDGKLFWIDEGVLEV
                     PIKIGRVDMNGQNPIVVFQDFAHPESLAVDTEKKMLYYSASNPAVIGSMDYNGADHTL
                     IVMKDSHPMAKPRSLGILDHRLYYLDPLYERIVRIDLPHGDNPKTIVDNESDLRSMMI
                     YKKRALMQHPCQTNNGGCKHLCIPGSGATRTCSCGIGYRKENEINCVAYKTFAVVSQL
                     DMIRGYSLSDSAEAMVPVSGPGHHILHVDVMYREQWIYWAEYNRGYWNGIFRSRPNGT
                     DLQHVVKDGIGSNGIRGLTIDWVAGNMYFTNVYPHENYVEVCWLDGSNRKVLVKTTTD
                     APRELAVNPVKRLLYWIDYGQHPRIGKALLDGSKWTPLVTSGISLPRDLTIDMQTHDI
                     YWVDSKLDTIQKISFNGANRKVIRRDLPNPMGIAVYLNDVYWVDRNLMTVFKASKHSA
                     NETATRVRTNLEKLRDIAIYNINNQPQDDTNPCAHLGNGGCDQLCFSFPPEGGATGPS
                     GRNFRCECATGKLSADERKCEVVNEYLVFATRTEIRAVNLDPHSTEVPFTPLTNLTNV
                     VGLDFDFADNRMLYTQIRPWAKIAYTKANKPGHDDITVVLNKGINPEGIAYDWTQSKI
                     YWTDSSNNSIYAMNLDGSELVMIARVERPRAIVLDPCNGTLFFTDWGRFGTSGKIFRT
                     TMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVREKIERSDLDGQNRELLVAATI
                     YPFAITVFRNYIYWTDLQLRGVYRAEKHTGANMVEMVKRLEDSPRDIRIYSADRQKCN
                     VNPCRINNGGCAQSCHPAPNGKAECKCDDNTKVVNEGRMCAPRNNTCEASKFYCKNGR
                     CISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCIFKSWKCDHENDCKDG
                     SDELGCTYPPCVDGEFTCGNGRCIPQAQVCNGVNDCKDNATSDETHERCPMNTTCPAN
                     HLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCPNHRCIPATWYC
                     DGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDCLDNSDEDNR
                     HQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTTLHNCATQQP
                     CGEDMFTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFTCQNFKCIRN
                     QSRCDGEDDCGDHSDEVGCAKENITCPQGQFACTNGQCIDYNLVCNKYPDCADESDEP
                     AHCNVDECAKVEINQCGHKCVDTLTGYYCDCNEGYKLLADGKACADVDECLEQPGACS
                     QHCSNTPGGFYCKCDETYYERQNDEHTCKRKDKIPPWLIFTNKYYVRNMSVDGHQYNL
                     MHQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMPPEREAVIRHDSHGLE
                     GIAIDWVGRKLYWLDRHSKNLDVSELDGTKRKTLRSGVVDPRAIVVHPGIGYLYFTSW
                     HLQAYIAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLDYIAYADLEG
                     RHRHTVLSGSKVPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVLRNTTHRPYD
                     LHINHPLRQLPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAPIFKCACPNQ
                     FYLARDMKTCVANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPATCAARHCRA
                     GTFQCKNTNCTPSATICDGVDDCGDRSDEQNCDLPCPLSDFKCKSSGRCILDSWRCDG
                     DADCKDGSDEDPAVCFKRTCDPKTEFACKNGRCIPQLWMCDFDNDCGDDSDEPAYMCR
                     QRNCTTGWQRCPGQSNYRCIPKWLFCDGKDDCRDNSDELPENCPKCNPETDFKCGNNR
                     CIPKQWMCDFADDCGDASDENEAVCKGRYRECSESEFRCGNGKCISSRWQCDHEDDCG
                     DNSDEMHCEGYQCKNGTFQCASGHCIASYFRCDGDRDCRDMSDEVGCPPRFPGGRYCP
                     ESRFQCNNNLCVSLSDLCDGTDDCGDGSDEDPSVCSDFNCDTLRRFQCSNHRCVARYQ
                     ICDGVDNCGDGSDENNMTLCASKQKPCDLYTQYQCANKHCIERSQVCDFSDDCGDASD
                     ELGCHHTSSCSEQNRGGCQHHCHNLTDGGYICTCYPGYIIAGDNKKKCSDVDECLTRQ
                     HTCSHQCHNLNGTYSCSCREGFHLTDGSSGVCRAEKEDVILVFANGQEIRGLDLQKRE
                     EFDVIAEEKRIEALDYDAQQQIVFWADSYDKTIKRSYMVNAIDGRAKIGFAQDLNMKG
                     GSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVMVAKTDGRYRRSIVNAGLEVPTSIAV
                     NPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEQIRHPAGLTIDYSQDHIIYWVDTK
                     LNAIESMRADGSRRKAIVKGDQLRHPVSLDLFESNMFWMTRDTGELVRQDKFGRGVQV
                     VLHRNLVNPSGLKVYHDKRYNTSLPNPCDNSTCSHLCLLVPGGHRCACPDASGPPPSH
                     RSTAEVICNAAAEHPRPAPRICPCQNGGLCKEDAQGELVCDCLAEFRGEHCETSTTGA
                     FGHGGANVTAVVVPIMVILLVMMAAAGAWYVIRKRPFGKLARMPAMTSSQSVTFRHGS
                     NVEFSESGFPGASAPGAGDVAPIEGYNLQTVNANKARDFANPMYDAVQSGTTADPGMG
                     NGSGIYDVPGEPSAKGKAMGHHAGGSFTEPASAIIAPSSITHKASPQLQLRTRELDPS
                     ADTGKDTQFLVEEDKSEC"
     misc_feature    1462..1560
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1477..1479,1501..1503,1534..1539)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1513..1515,1522..1524,1534..1536,1552..1557)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1543..1557
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    <1633..1701
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1648..1650,1657..1659,1669..1671,1687..1692)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1678..1692
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1870..1977
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1885..1887,1912..1914,1945..1950)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1924..1926,1933..1935,1945..1947,1963..1968)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1954..1968
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1990..2094
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2005..2007,2029..2031,2062..2067)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2041..2043,2050..2052,2062..2064,2080..2085)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2071..2085
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2107..2232
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2122..2124,2164..2166,2197..2202)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2176..2178,2185..2187,2197..2199,2215..2220)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2206..2220
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    <2335..2460
                     /gene="mgl"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:469594"
     misc_feature    <2470..2898
                     /gene="mgl"
                     /note="DNA-binding beta-propeller fold protein YncE
                     [General function prediction only]; Region: YncE; COG3391"
                     /db_xref="CDD:442618"
     misc_feature    2713..>3144
                     /gene="mgl"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    2713..2826
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2842..2958
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    2965..3075
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    3283..3411
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    3556..>3972
                     /gene="mgl"
                     /note="Sugar lactone lactonase YvrE [Carbohydrate
                     transport and metabolism]; Region: YvrE; COG3386"
                     /db_xref="CDD:442613"
     misc_feature    3760..3888
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    3913..4017
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    4450..4530
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4450..4452,4474..4476,4507..4512)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4486..4488,4495..4497,4507..4509,4525..4530)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4516..4530
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4552..4659
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: Ldl_recept_a; pfam00057"
                     /db_xref="CDD:395011"
     misc_feature    order(4570..4572,4594..4596,4627..4632)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4606..4608,4615..4617,4627..4629,4645..4650)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4636..4650
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4669..4767
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(4687..4689,4711..4713,4744..4749)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4723..4725,4732..4734,4744..4746,4762..4767)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4753..4767
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4792..4899
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4807..4809,4834..4836,4867..4872)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4846..4848,4855..4857,4867..4869,4885..4890)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4876..4890
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    4912..5019
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(4927..4929,4954..4956,4987..4992)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(4966..4968,4975..4977,4987..4989,5005..5010)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    4996..5010
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5056..5151
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(5059..5061,5086..5088,5119..5124)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5098..5100,5107..5109,5119..5121,5137..5142)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5128..5142
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5161..5259
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(5179..5181,5203..5205,5236..5241)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5215..5217,5224..5226,5236..5238,5254..5259)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5245..5259
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5293..5397
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(5311..5313,5341..5343,5374..5379)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(5353..5355,5362..5364,5374..5376,5392..5397)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    5383..5397
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    5554..5649
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    5863..5985
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    5989..6123
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    6058..6177
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    6124..6252
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7024..7152
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    7441..>7527
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    7765..7905
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    7966..8088
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    8044..8166
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    8722..>9120
                     /gene="mgl"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    8764..8853
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8887..9021
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    8998..9126
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    9586..9690
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9601..9603,9625..9627,9658..9663)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9637..9639,9646..9648,9658..9660,9676..9681)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9667..9681
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9703..9810
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9718..9720,9742..9744,9775..9780)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9754..9756,9763..9765,9775..9777,9799..9804)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    order(9784..9789,9796..9804)
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    9835..9936
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(9850..9852,9877..9879,9910..9915)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(9889..9891,9898..9900,9910..9912,9928..9933)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    9919..9933
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10087..10185
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10105..10107,10129..10131,10162..10167)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10141..10143,10150..10152,10162..10164,10180..10185)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10171..10185
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10225..10332
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10234..10236,10276..10278,10309..10314)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10288..10290,10297..10299,10309..10311,10327..10332)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10318..10332
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10369..10464
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(10384..10386,10408..10410,10441..10446)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10420..10422,10429..10431,10441..10443,10459..10464)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10450..10464
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10495..10599
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(10510..10512,10534..10536,10567..10572)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10546..10548,10555..10557,10567..10569,10585..10590)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10576..10590
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10615..10713
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(10633..10635,10657..10659,10690..10695)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(10669..10671,10678..10680,10690..10692,10708..10713)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    10699..10713
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    10762..10848
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    10864..10974
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    11071..11169
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11203..11331
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11389..11520
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    11479..11595
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11593..11721
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    11806..11964
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    11974..12075
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(11989..11991,12019..12021,12052..12057)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12031..12033,12040..12042,12052..12054,12070..12075)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12061..12075
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12100..12204
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12115..12117,12139..12141,12172..12177)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12151..12153,12160..12162,12172..12174,12190..12195)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12181..12195
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12214..12312
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12229..12231,12256..12258,12289..12294)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12268..12270,12277..12279,12289..12291,12307..12312)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12298..12312
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12337..12438
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12358..12360,12382..12384,12415..12420)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12394..12396,12403..12405,12415..12417,12433..12438)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12424..12438
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12466..12570
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12481..12483,12514..12516,12547..12552)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12526..12528,12535..12537,12547..12549,12565..12570)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12556..12570
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12598..12690
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12610..12612,12634..12636,12667..12672)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12646..12648,12655..12657,12667..12669,12685..12690)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12676..12690
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12724..12828
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12739..12741,12763..12765,12796..12801)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12775..12777,12784..12786,12796..12798,12814..12819)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12805..12819
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12841..12945
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(12856..12858,12880..12882,12913..12918)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(12892..12894,12901..12903,12913..12915,12931..12936)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    12922..12936
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    12973..13068
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(12988..12990,13012..13014,13045..13050)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(13024..13026,13033..13035,13045..13047,13063..13068)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13054..13068
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13114..13200
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(13114..13116,13138..13140,13171..13176)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(13150..13152,13159..13161,13171..13173,13189..13194)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13180..13194
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13243..13338
                     /gene="mgl"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(13249..13251,13273..13275,13306..13311)
                     /gene="mgl"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(13285..13287,13294..13296,13306..13308,13324..13329)
                     /gene="mgl"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    13315..13329
                     /gene="mgl"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    13354..13464
                     /gene="mgl"
                     /note="Coagulation Factor Xa inhibitory site; Region:
                     FXa_inhibition; pfam14670"
                     /db_xref="CDD:464251"
     misc_feature    13474..13569
                     /gene="mgl"
                     /note="Calcium-binding EGF-like domain; Region: EGF_CA;
                     smart00179"
                     /db_xref="CDD:214542"
     misc_feature    order(13474..13476,13483..13485,13525..13527)
                     /gene="mgl"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238011"
     misc_feature    13813..>14265
                     /gene="mgl"
                     /note="NHL repeat unit of beta-propeller proteins; Region:
                     NHL; cl18310"
                     /db_xref="CDD:302697"
     misc_feature    13858..13995
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    14005..14106
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
     misc_feature    14035..14160
                     /gene="mgl"
                     /note="Low-density lipoprotein receptor repeat class B;
                     Region: Ldl_recept_b; pfam00058"
                     /db_xref="CDD:459654"
     misc_feature    14107..14238
                     /gene="mgl"
                     /note="Low-density lipoprotein-receptor YWTD domain;
                     Region: LY; smart00135"
                     /db_xref="CDD:214531"
     misc_feature    14128..14253
                     /gene="mgl"
                     /note="NHL repeat [structural motif]; Region: NHL repeat"
                     /db_xref="CDD:271320"
ORIGIN      
        1 cagtcgctcg cggagcgtcg tcgtgaacgg tcagccagcg cggctaataa ctaactaact
       61 ttggtgacag tgcgccatac tgactctgat ccgaacccga atcgaggccc acagcagcca
      121 gaacatatta ccaacaatat atcagagcgg aaagtaaacg gagctactct gaacgaaaga
      181 aagaccttct ctaagataaa tcctgttgag tgtttcgagt tttttttcga gattgcagtg
      241 aaaaactcca agggatatgc aatttcctta tcaaacgaaa gagacggcaa caacaacagc
      301 aaccaaccga caagatgcca tcgccatctc cctcgcacca tattaatttt tatttttcaa
      361 gtgtctgaaa tacaacaacc gacgtaaaaa aaagaggagg aaaaaacgaa aataaaatat
      421 aaatacgcaa aggaaaatcg cgggaagaga cgagaaaagt ttaaagacgc cgaaggcaaa
      481 agttcacata aagcagccga aaaaagtttt tcaattattg taaaaagtgt taaaaagata
      541 gggccaacgc gagcgagcga gcgagagcga gagggggcta gagtgcgaga gtgcgagaac
      601 gagacagcca gcaattatct ttcataagca aaaaagttta gcagcaggca aaagagcaaa
      661 cggaataaga cgaacggggg ggaatttaat taaatttaat taattgctct ttcaagtgcc
      721 cccgcggcaa cgcccacaaa agcaaataaa ttaaaaatat taaacgcgtt aattttccgc
      781 ttatttcatt aaagcagcag cccaccaaac aaaaaccaaa caaaaatatt tcgaaaaaga
      841 atagagaaat caagccagaa gagagggaat tctcaaaggc agaagacaga agaccggtgg
      901 gcagagaaga ggtcaccaga aggtcaccga aaccccaaaa aagaatccaa acctaaaccc
      961 acggataaga agcaaaggag cgaaggagcc agcgaagcga ccaacgaacc aaaaatgaat
     1021 ccgacgccca tgggcattgg attcggattt ggtcgcaagc cgcccaacaa ggccagaatg
     1081 cgttcccgct ggcgaccacc gccgccggcg acaaccctgc tgacccctga ccccgccgag
     1141 ggcgacaacc cggcagccga tccgctgcag gtcacagagg cctccgcctc agcttcggcg
     1201 ccatcctcgc ccatcggcga ccaccgccat ccgcagctgg acagcagcag agctgccgag
     1261 ccgaggctgc agcaccagca acaggaagca cagcactacc gccagcaccg cggccagttg
     1321 acaaccctgg cgctgctgct actggccctc gtagccctca gcaacctgga aaccctgctc
     1381 gccgtgcgca ccgaaggacc gcgcaaccgc catggatcac caggtggcag cttgggcagc
     1441 acaggcggca tcaataccga gtgtccgacg gactccttcc gctgcaacaa cggcaagtgc
     1501 atctcgcacc actgggtctg caattaccaa aaggactgcg acgatggcga ggacgagatg
     1561 cagtcgtgcc ccccaccgga atgcgaaact ccccagctga actgcgggca gtatgtgttc
     1621 aacaagacct attgcatccc tccgcactat cgttgcgata tgatcgagga ttgcgaggac
     1681 aaatcggacg aggcccagtg cacttaccgc aagtgccagc acacggacgt cttctgcaac
     1741 gcccccaatg gagccgcccc cgcggagggc gcccgcctgg ccggaccctg tgtgccgaag
     1801 gagaaacgct gcgacggcta cctggactgc cgcaccggga aggacgagga gggctgcagc
     1861 ggcgtctcct gtcgcctcga ccagttccgc tgcgccaatg gacacaagtg catcgatgcc
     1921 gctctgaagt gcaaccaccg cgacgactgt ggcgataatt ccgacgaaca gggatgcaac
     1981 ttcccgccct gccaccacgc ccagttccgg tgctcgaacg ccctatgcat tccgtacaac
     2041 ttccactgcg atggctacca cgactgcgcc gacaagagcg acgaggccaa ctgcacggcc
     2101 atcgcctgtc cggacaacaa gcacctctgt ccacgaggag gcgccagcgg aacacccaag
     2161 tgcatcctga agtcccaact gtgcgacggc aagcgggact gcgaggatgg tagcgacgag
     2221 gagaccaact gttcgattgc ctcttgccca gctctgagtt gtgagttcaa gtgcggaccc
     2281 tcgctgaccg gaggcgtgtg ctactgcaaa cctggtcaat cgctggcccc ggacaaccga
     2341 acttgtgtgg acctcgacga gtgcgccgag tggggtcact gcgaccagct gtgcacgaac
     2401 accctgggct cgtacacctg ccagtgtgcc cagggctaca cgctgatcaa cgactccaag
     2461 tgcattgccc cggatgcgaa taacctgcag ctgatcttcg cccacgatcg tgccataatg
     2521 caaatgaagc cgcatggcag tgaacctatg gtactggcca atgccaccgc tgcggccgga
     2581 gtgaccttcc attatgcgag gaatacgctc tactggtcgg acatcaagac aaggaaggtt
     2641 caatctctgc ctctggatgc acagaacaag gctgtctcgc cattcgatca aacgctaccc
     2701 ggaacctggg ctcccgtagc tctggccgtc gattgggtgg gcgataagat atatgtggcc
     2761 gatttggtgg gtcagaagat cgatgtcttc gagctgagtg gtcaatggca tgccgtggtc
     2821 ctaggttcaa acctcacctc gcccgccgac ctcgctttgg atcccacggc tggtctgatg
     2881 ttcgtggcgg atggtggtca agtgctccgt gcccacatgg atggaaccca tgcccgttcg
     2941 attgtctcgg aggctgccta caaggcgagc ggcgtgacgg tggacatcat tgccaagcgc
     3001 gtcttctggt gcgactccct gctggattat attgagtcgg tagactatga gggtggtcat
     3061 agggttatgg tccttcgagg acagcaagtg cctagtccct cgcgactcgc tctgttcgaa
     3121 aaccgcatct actggacgga tgccaccaag cagggcatca tgtcggtgga caagttcgag
     3181 ggtcccacct ccattcaggt gacccacaag tccaaggaca ttcgggagcc caaaggcatc
     3241 attgcggtgc atgcactgag tcaaccgagg gtctcgaatc catgtggcaa taacaatggt
     3301 ggctgcaatc atatgtgcat cgtcaccgcg gtcaagggag ctcccacggg attgggtttc
     3361 cgttgcgcct gctcgacggg ctatcaactg gagacggact tgaagctttg caaaccggtt
     3421 agcgagttcc tcatgtactc gcaacagcga tttatcaagg gcaaagtatt agagcccgtg
     3481 atcgagggct tcagcgatgc cattatgcca gtggtttccc gccgagctcg tttcgttggc
     3541 ctggatttcg atgcccgcga tgagttcatc tactactcgg acgttctgca ggatgtgatc
     3601 tatagggtgc atcgaaatgg aacaggtcgc gagattgttt tggcctccca aaatgagggc
     3661 gtcgagggac tggctgtcga ttgggcctct aagaatctct actacatcga ttcacgcaag
     3721 ggcaccttga atgtcttgtc cacgaggaat gtcactcatc gcaggactct gctgaagaat
     3781 ttgaaacgtc caagggccat tgtggtccac cctaatcgcg gcttcatctt cttctccgaa
     3841 tgggatcgac cggcgaatat cacgcgggca aacaccgatg gcagtggtct gttggtcttc
     3901 aagaacgtca ctttgggatg gcccaatggt ctgtctattg acttcaagga ggatagggtt
     3961 tactggtgcg atgccttgct agaccatgtt caacatgcca atttggatgg cacggacatc
     4021 aagacagtga actcgcgact ggtgcgacat cccttctcga ttgtcatcca caacgattgg
     4081 atgtatatta cggactggcg attggatgcc attatcaggc tgcacaagct gacgggcgag
     4141 caggaggaga tgatggtgag ggagccgcag accaacaggc tgtatggggt taaggtgtac
     4201 agtcacgagg ttcagaggat cgcggagacg caaccctgtc accggaacaa cgggggatgc
     4261 cagaagatct gctttgcggt tccgattgga ggagggaatg ctacaacgaa tggaggtaca
     4321 ccctcctttg gtcgcctgca gtcgcggtgc tcgtgtccct atggcgagcg gctggccgag
     4381 gatcagatga gctgcatccc cgatccgagt gccgagccgc cggtgcagcc gtgcccgaac
     4441 tcctgggact tcacgtgcaa caaccagcgg tgcattccca agtcgtgggt ctgcgatggc
     4501 gacgacgact gcctggacaa cagcgatgag gagcagaact gcacgaaacc cacctgcgga
     4561 tcgaacgagt tccagtgccg atcgggccgc tgcattccgc agaacttccg ctgcgaccag
     4621 gagaacgact gtggcgacaa ctcggacgag caggaatgcg gcaacgtgac ctgcggcacc
     4681 tcgcagttcg cctgcgccaa tgggcgatgc attccgaata tgtggaagtg cgacagcgag
     4741 aacgattgtg gggatagcag cgatgagggt gacttttgtg ccgagaagac ctgcgcctac
     4801 ttccagttca cgtgtccgcg gacgggtcac tgcataccgc agagttgggt gtgcgacggc
     4861 gacgacgatt gcttcgacaa gcaggacgag aaggactgtc cgccgatctc ctgtctggcc
     4921 aatcagttca agtgcgccga tctgcggcag tgcgtcgagg agtcgtacaa atgcgatggc
     4981 ataccggact gcaacgatgg ctccgacgag gtgggctgcc cgcccatggg cccgaatcag
     5041 tgtaatctcg agaagcactt ccgctgcaag tctactggct tctgtatacc catcgcctgg
     5101 cattgtgatg gctcgaatga ttgctcggat cattcggatg agcaggactg cggtcagatc
     5161 acctgtgccc agaacttctt caagtgcaac aacacgaact gtgtgttcaa ggcctacatt
     5221 tgcgacggca aggacgattg tggtgataac tcggatgagg gtgccgagca tgcctgtgtt
     5281 ccgccgccct tcaagtgtcc ccacggtcag tggcaatgtc ccggggtctc ggagagatgc
     5341 gtgaacataa cctccgtttg cgatgacacc gccgattgtc ccaatggttc cgatgagggt
     5401 gaaggttgcg acctcgccga gtgcgaacat caggcgggtc agtgctccag tttctgtcag
     5461 aagaccccga atggagctct gtgcatctgt ccacctggtt cggagatcgg agaagatggc
     5521 tatacctgta tagacactaa tgaatgcgat cccccgggtc tctgttctca acagtgtacg
     5581 aacaccaagg gctcgtactt ctgttcctgc caagagggtt acattttgga gcccaataag
     5641 cacacctgca aggcagtcaa tcacaccgcc gccttcctga tcatctccaa taggcattct
     5701 atcctagtgg ccgatctcaa ggaacaggga ctggaaaggg tgcccattat agtggagaat
     5761 gtggtggcca ccgcttcgaa catgcacacg ggcaccattt tctggagcga catgaagctg
     5821 aagaagatct cgcgattgga taggggaatg gaaccgcagg agattatcaa cacgggattg
     5881 gatctggtgg agggactggc ctacgattgg atagcccaga atctctactg gctggacagc
     5941 aagctgaaca cgatcgaggt gtcggcggag aatggttcga atcgattggt tcttgttaga
     6001 gagaacatca ctcagcccag aggcatgtgc atcgatccga gtcccggggc aagatggatc
     6061 ttctggacgg actggggtga gaatccgcgg gtggagcgga tcggcatgga tggaacgatg
     6121 aggaagacga tcatcaatac gaagatctat tggcccaatg gtttgaccct ggacatagcc
     6181 accaagcggg tttactttgc ggattccaag ctggacttta tagacttttg ctactacaat
     6241 ggaaccggga gacagcaggt tttggccagc agtcactacc tcctgcatcc gcactcgctg
     6301 tccctcttcg aggataccct gtactggacg gacaggcaat tgaatcgggt tctctcggcg
     6361 aataagttta ggggcaagaa tcagacggtg gtttcgcacc tgattagcca accgctgtcc
     6421 atccacgtgc atcatgcctc cctgcagccg atgaccccga atccctgtgc ctcagcacgc
     6481 tgccagcatc tgtgtctgct gagtcccagc gcctcggagg gctactcgtg caagtgcaag
     6541 ccgggcttca agctgctcag cgagggtcgc tgcatcgagg aggagaatcc cttcctgatg
     6601 gtcgtcaagg gcacgcagat agtggatctt ccgctgaatg gtggcgatgc gagggcagga
     6661 gccttggctc cggtgattgg aatcgagagc agcactggcc tggactttga tcgcaaggga
     6721 gagaccctct attgggtgca gggcagggag gatgatgacg agaattgcac tatctatacg
     6781 acaccatacg gaggtggcaa caagaccctc ttcctgggca ccgaaagcgg cattgtcgga
     6841 gcaccctaca ccattgcctt cgattggttg ggtcggaatc tctacattgg caaccgggtg
     6901 gccagtaata tcgaggcagt gcgagtggat ggaaagcaaa agtaccggac aatcatccta
     6961 gccaacgatg gttatgccaa ctcggtgtcg cgacccaagc aaatagtgct cgatcccacc
     7021 gacggcaagc tcttctggat cgacgagggc gtgctggagg tgcccatcaa gatcggcagg
     7081 gtggacatga atgggcagaa ccccattgtg gtcttccagg actttgccca tcccgaatcg
     7141 ctggccgtgg acacggagaa gaagatgctc tactacagtg ccagcaatcc ggcggtgatt
     7201 ggttcgatgg attataacgg agctgatcac acgctgattg tgatgaagga ctcgcatccg
     7261 atggccaagc cgaggagtct gggcatcctg gatcaccgac tatactattt ggatcccttg
     7321 tacgagcgga ttgtgcgaat cgatctgccg catggcgata atcccaagac aattgtggat
     7381 aatgaatcgg atttgagatc gatgatgatc tacaagaagc gcgctttgat gcagcatccc
     7441 tgccagacga acaacggcgg ctgcaagcat ctctgcattc cgggatcggg agctacgagg
     7501 acctgctcct gcggcattgg ttatcgcaag gagaacgaga tcaattgcgt ggcctacaag
     7561 accttcgcgg tcgtctccca gctggacatg atcaggggat atagcttaag tgacagtgca
     7621 gaggccatgg ttccggtgag cggacctggt catcacatcc tccacgtgga cgtcatgtat
     7681 cgggagcaat ggatctactg ggcggaatac aatcggggct actggaatgg catcttcagg
     7741 tcgcgaccca atggcaccga tctgcagcat gtggtcaagg atgggatcgg aagcaatggc
     7801 atccggggac tgaccatcga ttgggtggcc ggtaatatgt actttaccaa tgtctatccg
     7861 catgagaatt acgtggaggt ctgctggctg gacggtagca ataggaaggt gttggtcaag
     7921 accaccacgg atgcaccgcg tgaactcgcg gtgaatcccg tgaagaggct gctctactgg
     7981 atcgactatg gtcagcatcc gaggattggg aaagctctgc tggacggaag caagtggacg
     8041 cctttggtga cgtcggggat ctcgttgcca cgcgatctaa ccatcgatat gcagacgcat
     8101 gacatctact gggtggactc gaaactggac accatccaga agatctcctt taatggggcc
     8161 aatcgcaagg tcattcggag ggatctgccc aatcccatgg gcatcgctgt ctatctgaac
     8221 gacgtgtact gggtggacag gaacctgatg accgtgttca aggcctccaa gcacagtgct
     8281 aatgagacgg ccaccagggt gaggacgaat ctggagaagc tgagggacat tgcgatctac
     8341 aatatcaaca atcagccgca ggacgatacc aatccttgtg cccacttggg caacggcggc
     8401 tgcgatcagt tgtgcttcag tttcccaccc gaagggggag ccaccggtcc atcgggcagg
     8461 aatttccgtt gcgagtgtgc gacgggtaag ctgagtgccg acgagcgaaa gtgcgaggtg
     8521 gtcaacgagt atctggtctt tgccacacga accgaaattc gagccgttaa cctcgatccc
     8581 cattccacgg aggtgccttt taccccgctg actaatctca cgaatgtcgt gggtctggac
     8641 tttgatttcg cggacaatcg aatgttgtat acgcagattc gcccatgggc caagatcgcc
     8701 tatacgaagg cgaataagcc gggacacgat gacatcacgg tggtgctgaa caagggcatc
     8761 aatcccgagg gcattgcgta cgattggacg cagtcgaaga tctattggac ggacagctcg
     8821 aacaactcga tctatgcgat gaatctggat ggcagtgaac tggtgatgat tgcccgggtg
     8881 gagcgtcccc gagcgattgt cctggatccc tgcaatggaa cgctgttctt cacggattgg
     8941 ggaagattcg gaacctctgg caagatattc cgcacgacga tggcgggatc tctgaagaga
     9001 gcgatcgtgg ataaggacct gtcgcagccc agtggcctgg ccatcgatta cgatgagagg
     9061 aggttgtatt ggacggatgc ggtgagggag aagatcgagc gatccgattt ggatggtcag
     9121 aacagggagc tcctggtggc cgccaccata tatcccttcg cgatcaccgt gttccgtaac
     9181 tacatctact ggacggatct ccagctgcgc ggtgtctacc gggcggagaa gcacacgggt
     9241 gcgaatatgg tggagatggt gaagcgactg gaggattcgc cgcgagacat tcgcatctac
     9301 agtgcggatc ggcagaagtg caatgtgaat ccgtgcagga tcaacaatgg gggatgtgcc
     9361 cagagttgtc acccggcgcc gaatggcaag gccgagtgca aatgcgatga taatacgaag
     9421 gtggtgaacg agggaaggat gtgtgcaccg aggaataata cgtgcgaggc cagcaagttc
     9481 tactgcaaga atggcaggtg catttcgagg atgtggtcct gcgatggcga cgacgactgt
     9541 ggggataatt ccgatgagga tcccaactac tgtgcctatc actcctgctc gccgaatgag
     9601 ttccgttgca acaatggtcg gtgtattttc aagtcttgga agtgcgatca cgagaacgat
     9661 tgcaaggatg gctccgatga gctgggctgc acctatccgc cctgcgtcga tggtgagttc
     9721 acctgcggca atggcaggtg tattccccag gcccaggtgt gcaatggggt gaacgattgc
     9781 aaggacaatg ccacctcgga cgagacgcac gagaggtgtc ccatgaacac cacctgtccg
     9841 gcgaatcatc tcaagtgcga gaagacgaat atctgtgtgg agccctattg gctgtgcgat
     9901 ggcgacaacg attgcggcga caactccgac gaggatcccc tgcattgtgg tcagagaact
     9961 tgtcccacga acagcttccg ctgccccaac caccgatgca ttccggccac ctggtactgc
    10021 gatggcgacg atgattgcgg cgatggcgcc gacgagccac cagattactg caagtccgaa
    10081 ggacgcactt gcttcgggga tctcttcacc tgcgacaatg gcaactgcat acccagaatc
    10141 tacatttgcg acggtgacaa cgattgcctg gacaacagtg acgaggacaa ccggcatcag
    10201 tgcaatgacc gaaagtgtga tgaggaaacg gaattcacct gcgtggagaa caagtcctgg
    10261 cagcgagccc agtgcatccc caaaaaatgg atctgcgacg gagatccgga ttgtgtagat
    10321 ggagccgacg agaacaccac cctgcacaac tgtgctacgc agcaaccctg tggcgaggac
    10381 atgttcacct gcggcaacgg acgctgcatc aataagggat ggatctgcga ccatgacaac
    10441 gattgcggcg acggcaccga cgagggcaag ttctgcaact ccaagtacaa gacctgctcg
    10501 gcccaggagt tcacctgcca gaacttcaag tgcatccgca accagtcgag gtgcgatggc
    10561 gaggacgact gcggcgatca ctcggacgag gtgggctgcg ccaaggagaa catcacctgt
    10621 ccgcagggac agttcgcctg tacgaatggc cagtgcatcg actacaatct ggtgtgcaac
    10681 aagtatcccg actgtgccga cgagtccgat gagccggccc actgcaacgt ggacgagtgc
    10741 gccaaggtgg agatcaatca gtgcggccac aagtgcgtgg acacgctgac gggctactac
    10801 tgtgactgca atgagggcta caaacttctg gccgacggca aggcatgtgc ggatgtggac
    10861 gagtgcctgg agcagccggg cgcctgttcc cagcactgtt cgaacacccc gggtggattc
    10921 tactgcaagt gcgatgagac ctactacgag cggcagaacg atgagcacac gtgcaagcga
    10981 aaggacaaga taccaccctg gctgatcttc accaacaagt actatgtgcg aaatatgtcg
    11041 gtggatggac atcagtacaa tttgatgcac caggatctga tgaatgtggt ggccctggac
    11101 tttgacattc gcgaggagta catgtacttc tgcgacgtga cggccaagac gatattccgg
    11161 gccaagtatg gggaggcaga tgacgagatg ccgccggagc gggaggctgt gatcaggcac
    11221 gattcccatg gactggaggg catcgccatc gattgggtgg gtcgcaagct ctactggttg
    11281 gacaggcact ccaagaacct ggatgtttcc gaactggatg gaaccaaacg caagaccctg
    11341 aggagtggtg tcgttgatcc gcgtgccatt gtcgtgcatc ctggcatcgg ttatctgtac
    11401 ttcacctcct ggcatctgca agcctacatt gccaaaatgg gcatggatgg ttcgaacttc
    11461 tcgaggatcc tgaactggaa cgacggtatc gcctggccga atgccctgtc cattgactac
    11521 ttcacggatc gtatttactg ggcggacgcc cacttggact acatagccta tgctgatttg
    11581 gagggcaggc atcggcatac ggtgctctct ggcagcaagg tgcctcatgt gtttgcactg
    11641 agtctcttcg acgactacat ctactggagt gactggaatc tgaaggccat tgtgcgggcc
    11701 aacaagttcc atggtgccaa ctacacggtg ctgaggaata ccacccatcg tccctacgac
    11761 ctgcacatca atcatccgct gaggcaactg ccctacacca atccctgtgg caccaacaac
    11821 ggcggttgct cgcatctctg cctgatagct ccaccgccgg agtccacgta cctgaatatc
    11881 gagggctata tcgaggaggg agctccgatc ttcaagtgcg cctgtcccaa tcagttctac
    11941 ttggcccggg acatgaagac ttgcgtggcc aattgcacgg ccgggcagca tttgtgcggc
    12001 ggtcgggatg agaagtgcat accgtggttc tggaagtgcg acggggagaa ggactgcaag
    12061 gatggcagcg atgagccagc cacctgtgcc gcgcgacact gccgggccgg aacgttccag
    12121 tgcaagaata ccaactgcac accctcggcg accatttgcg atggcgtgga cgactgcggt
    12181 gatcgtagcg acgaacagaa ttgcgatcta ccctgcccgc tgtccgattt caagtgcaaa
    12241 tccagtggta ggtgcatcct ggacagctgg cgctgcgatg gcgatgccga ctgcaaggat
    12301 ggcagcgacg aggaccccgc cgtgtgcttc aagcgcacct gcgatcccaa gacggagttt
    12361 gcctgcaaga atggccgctg cattccgcaa ctgtggatgt gcgatttcga caacgattgc
    12421 ggcgatgatt ccgatgagcc ggcgtacatg tgccgccagc gcaactgcac caccggctgg
    12481 cagagatgcc ctggtcagtc gaactaccgc tgcattccca agtggctgtt ctgcgacggc
    12541 aaggacgatt gtcgggacaa cagcgacgag ctgccagaga actgccccaa gtgtaatccc
    12601 gagacggact tcaagtgcgg caacaaccga tgcataccca agcaatggat gtgtgacttt
    12661 gcggacgatt gtggcgatgc tagcgatgag aacgaggctg tctgcaaggg tcgctatcgg
    12721 gagtgctccg aatcggagtt ccgctgcggc aacggcaagt gcatctcctc ccggtggcag
    12781 tgcgatcatg aggacgactg cggcgacaac tcggacgaga tgcactgcga gggctatcag
    12841 tgcaaaaacg gcaccttcca gtgcgcttcc ggtcattgca tagcctccta cttccgttgc
    12901 gacggcgatc gcgattgccg cgacatgtcc gacgaggtgg gctgtccgcc gcgcttcccg
    12961 ggcggtcgct actgtcccga gtcgcgtttc cagtgcaaca acaacctgtg cgtctcgctg
    13021 tcggacctct gtgacggcac agatgattgc ggtgatggca gcgacgagga tcccagcgtt
    13081 tgcagtgact tcaattgcga taccctgcgg cgattccagt gctccaatca tcgatgcgtg
    13141 gctcgctatc aaatctgcga tggtgtggac aactgcggcg atggcagtga tgagaacaac
    13201 atgaccctgt gtgccagcaa acagaagccc tgcgatctgt acacccagta ccagtgcgcc
    13261 aacaagcact gcatcgaacg ctcgcaggtg tgcgacttct ccgacgattg tggcgatgcc
    13321 agcgatgagt tgggctgcca ccacacgagc agctgctccg aacagaatcg cggtgggtgt
    13381 cagcatcact gccacaatct caccgacggt gggtacatat gcacctgcta tcccggctac
    13441 atcatagccg gcgacaacaa gaagaagtgc tccgacgtgg acgagtgcct cacgcgacag
    13501 cacacgtgtt cgcatcagtg tcacaatctc aatggcacct actcgtgcag ttgccgcgag
    13561 ggtttccatc tgaccgacgg ctcgagtggc gtttgtcgtg ccgaaaagga ggatgtcatt
    13621 ttggtatttg ccaacggtca ggagatccga ggtttggacc tccagaaacg cgaggaattc
    13681 gatgtgattg cggaggagaa gcggatcgag gcactggact acgatgccca gcagcagatc
    13741 gtcttttggg cggatagcta tgacaagacg atcaagcgtt cgtacatggt gaatgccatc
    13801 gatggcaggg ccaagattgg ctttgcccag gatctgaaca tgaagggagg atcgaaaccc
    13861 accgccgtgg ccgtcgattg gctggcctcg aatctctact ggacggaaat ggacaggacg
    13921 ggctcgaagc cgcgtggtcg agtgatggtg gccaagacgg atggaaggta tcgcaggtcg
    13981 attgtgaatg ccggtctgga ggtgcccact tcgatagcgg ttaatccaca gctgggcagg
    14041 atctactggt cggatgcggg ctccgcgccc aagatagagg tctcctggat ggatgggtcc
    14101 aagcggcgac cgctgatcac cgagcagatt cgtcatcccg ccggcctgac catcgattac
    14161 tcgcaggatc acatcatcta ctgggtggac accaagctga atgccattga atcgatgcgg
    14221 gccgatggtt cgcgtcgcaa ggccattgtg aagggtgacc agctgaggca tcccgtttcc
    14281 ctcgatctct tcgaatccaa catgttctgg atgacacgcg acaccgggga gctggtgcgc
    14341 caggataagt tcgggcgcgg agtgcaggtg gtgctgcatc gcaacctcgt caatccgtcc
    14401 ggcctgaagg tctaccacga caagcggtac aacacctcgc tgcccaatcc gtgcgacaac
    14461 tccacctgct cgcacctctg cctcctggtg cccggcggcc atcggtgcgc ctgtcccgac
    14521 gcctccggtc cgccgccctc gcatcgcagc accgccgagg tgatctgtaa tgccgccgcc
    14581 gagcatccgc gtccggcgcc gaggatttgt ccctgccaga acggcgggct ctgcaaggag
    14641 gatgcccagg gtgagctcgt ctgcgactgt ttggccgagt tccggggcga gcactgcgag
    14701 acgagcacca ccggagcctt tggtcatggg ggcgccaatg tcaccgccgt cgtggtgccc
    14761 atcatggtca tcctgctggt gatgatggcc gccgccggcg cctggtacgt catccggaag
    14821 agaccttttg gcaaattggc tcgcatgccg gcgatgacct cgtcgcagag cgtgaccttc
    14881 cgccacgggt cgaatgtgga gttcagcgag agcggcttcc cgggggcatc cgcaccgggg
    14941 gccggcgatg tggcgcccat cgagggctac aacctgcaga cggtgaacgc gaacaaggcg
    15001 cgcgactttg ccaatccgat gtacgatgca gtgcagtcgg gcaccaccgc cgatccaggc
    15061 atgggcaacg gctcgggcat ctacgatgtg cccggcgaac cgtcggccaa gggcaaggcc
    15121 atgggccacc atgcgggcgg atccttcacg gagcccgcct cggcgatcat cgcgcccagc
    15181 agcatcacgc acaaggcgtc gccgcagctg cagctgcgca ccagggagct ggacccctcg
    15241 gcggacaccg gcaaggacac ccagttcctg gtggaggagg acaagtccga gtgctgatat
    15301 caagcccgtc aatcggctgc agttgcgatg gccagctgtc gccggcagca gcagcagcag
    15361 aagcagcaga agcatccgga gaacagctat ccgctgcaga cataacacag actggtcaag
    15421 caaaggaagg agcagcagca