Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396182 1733 bp mRNA linear INV 09-DEC-2024 transcript variant X2, mRNA. ACCESSION XM_044396182 VERSION XM_044396182.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1733 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1733 /gene="gd" /note="gastrulation-defective; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108069739" CDS 105..1733 /gene="gd" /codon_start=1 /product="serine protease gd" /protein_id="XP_044252117.1" /db_xref="GeneID:108069739" /translation="MRLPLTALCICILILCIELVSKAVAQGMPVSPCPKIFQYRFDGS EWFGLMAVRSPDGHQPLHIRVTLSMRGKPTTNYLGEIELLTRGKFAHNAPVLYKIRFP KHHFPPKLLLLSANNHVICFGSGEHSIFMTQIQLEHIRKLAFIPDKISSLLLDPHEQG EGEEADTKAEEEAKKTHIQFKKKPFVQALKDICGRIDRDLDFRLSQKRDQEGEQEQES EPILGSEAITSPVFVEDNDGEDAHGLEHFVDETEEEENESLDDSASLPSITRGSWPWL AAIYVNNLTSLDFQCGGTLVSGRVVISSAHCFKLFNKRFTSNEVLVFLGRHNLKNWNE EGSLAAPVDGIYIHPDFNSQLSSYDADIAVIMLKDEVRFNTFIRPACLWSGSSKAEYI VGEQGIVIGWSFDRANRTQDQKLSPVALGGKKSSDSHSAPKVVKAPVVGNAECFRANA HFRSLSSNRTFCAGIHTEERDRHQQISASIYTGISGAGLFIRRNNRWMLRGTVSAALP AVESPEPGYVCCRSQYIIYADVAKFLDWITAFVI" misc_feature 195..479 /gene="gd" /note="Serine protease gd N-terminus; Region: GD_N; pfam16030" /db_xref="CDD:464985" misc_feature 906..1715 /gene="gd" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature order(1020..1022,1185..1187,1557..1559) /gene="gd" /note="active site" /db_xref="CDD:238113" misc_feature order(1515..1517,1614..1616,1650..1652) /gene="gd" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 tcgcaatcga tattgcgctg aattgcagta gtgacacctt cagatcgaga tccagctcct 61 gatcagacca gaaacacccc gtcgcatccc gtcccgacat tgagatgcgg ctgcccctga 121 cggcgctctg catctgcatt ctgatcctct gcatcgagct cgtgtccaag gcggtcgccc 181 aggggatgcc cgtcagtccg tgtcccaaga tattccagta ccgcttcgac ggcagcgagt 241 ggttcggcct gatggccgtg cgcagtccgg atggccacca gccgctccac atccgggtga 301 cgctctccat gcggggcaag cccacaacga actaccttgg tgaaatcgag ctactgaccc 361 gcggaaagtt cgcccacaac gcgccggtgc tctacaagat ccgtttcccc aagcaccact 421 tcccacccaa actgctcctc ctgtcggcca acaaccatgt gatctgcttt ggatccggcg 481 agcacagcat cttcatgacc caaatccagt tggagcacat caggaaattg gcctttattc 541 cggataagat cagctcccta ctgttggatc ctcacgagca gggggagggg gaggaggcag 601 acacgaaggc ggaagaggag gcgaagaaga cgcacatcca gttcaagaaa aaaccctttg 661 ttcaggcgct taaggatatt tgcggacgca tcgacaggga tctcgacttt cggctgtccc 721 aaaaaaggga tcaggaaggg gaacaggaac aggaatcgga acctatcctt ggctcagaag 781 ccataacatc gccggtgttt gttgaagaca acgacggaga ggatgctcat ggcttggagc 841 actttgtaga cgaaacggaa gaggaagaaa acgaatcgct ggatgatagt gcgagcctgc 901 cgtcgatcac caggggatcc tggccctggc tggcggccat ctatgtgaac aacctgacct 961 ccttggactt ccagtgcggc ggaaccctcg tctcggggcg cgtggtcatc agctcggcgc 1021 actgcttcaa gttgttcaac aagcgcttca catccaacga ggtcctcgtc ttcttgggcc 1081 ggcataatct caagaactgg aacgaggagg gctcattggc ggcccccgtg gacggcattt 1141 acatccatcc cgacttcaac agtcagctga gcagctacga tgcggatatc gccgtgatca 1201 tgctcaagga cgaagttcga ttcaacacct tcattcgccc cgcttgcctg tggtccggtt 1261 ccagcaaggc ggagtacatt gtaggcgagc agggcatcgt cattggctgg agctttgaca 1321 gagcgaacag gacgcaggat cagaagctgt cgccggtggc tctggggggt aagaaatcca 1381 gcgattcgca cagtgccccc aaggtggtga aggctccggt tgtcgggaat gccgagtgct 1441 ttcgggctaa tgcccacttt cgcagcctct cctccaaccg aactttttgc gccggcatcc 1501 acacggagga gcgggatcgc catcagcaga tcagtgccag catttacaca ggcatttcgg 1561 gagccgggct ttttatccgg cgtaacaatc gctggatgct gcgcggcaca gtgtcagctg 1621 ccctgcccgc cgttgaatcg ccagaaccgg gttacgtttg ctgtagaagc cagtacatta 1681 tatatgctga cgtggccaag ttcctcgatt ggatcacggc cttcgtaatt taa