Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii gastrulation-defective (gd),


LOCUS       XM_044396182            1733 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_044396182
VERSION     XM_044396182.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1733
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1733
                     /gene="gd"
                     /note="gastrulation-defective; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108069739"
     CDS             105..1733
                     /gene="gd"
                     /codon_start=1
                     /product="serine protease gd"
                     /protein_id="XP_044252117.1"
                     /db_xref="GeneID:108069739"
                     /translation="MRLPLTALCICILILCIELVSKAVAQGMPVSPCPKIFQYRFDGS
                     EWFGLMAVRSPDGHQPLHIRVTLSMRGKPTTNYLGEIELLTRGKFAHNAPVLYKIRFP
                     KHHFPPKLLLLSANNHVICFGSGEHSIFMTQIQLEHIRKLAFIPDKISSLLLDPHEQG
                     EGEEADTKAEEEAKKTHIQFKKKPFVQALKDICGRIDRDLDFRLSQKRDQEGEQEQES
                     EPILGSEAITSPVFVEDNDGEDAHGLEHFVDETEEEENESLDDSASLPSITRGSWPWL
                     AAIYVNNLTSLDFQCGGTLVSGRVVISSAHCFKLFNKRFTSNEVLVFLGRHNLKNWNE
                     EGSLAAPVDGIYIHPDFNSQLSSYDADIAVIMLKDEVRFNTFIRPACLWSGSSKAEYI
                     VGEQGIVIGWSFDRANRTQDQKLSPVALGGKKSSDSHSAPKVVKAPVVGNAECFRANA
                     HFRSLSSNRTFCAGIHTEERDRHQQISASIYTGISGAGLFIRRNNRWMLRGTVSAALP
                     AVESPEPGYVCCRSQYIIYADVAKFLDWITAFVI"
     misc_feature    195..479
                     /gene="gd"
                     /note="Serine protease gd N-terminus; Region: GD_N;
                     pfam16030"
                     /db_xref="CDD:464985"
     misc_feature    906..1715
                     /gene="gd"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    order(1020..1022,1185..1187,1557..1559)
                     /gene="gd"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(1515..1517,1614..1616,1650..1652)
                     /gene="gd"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 tcgcaatcga tattgcgctg aattgcagta gtgacacctt cagatcgaga tccagctcct
       61 gatcagacca gaaacacccc gtcgcatccc gtcccgacat tgagatgcgg ctgcccctga
      121 cggcgctctg catctgcatt ctgatcctct gcatcgagct cgtgtccaag gcggtcgccc
      181 aggggatgcc cgtcagtccg tgtcccaaga tattccagta ccgcttcgac ggcagcgagt
      241 ggttcggcct gatggccgtg cgcagtccgg atggccacca gccgctccac atccgggtga
      301 cgctctccat gcggggcaag cccacaacga actaccttgg tgaaatcgag ctactgaccc
      361 gcggaaagtt cgcccacaac gcgccggtgc tctacaagat ccgtttcccc aagcaccact
      421 tcccacccaa actgctcctc ctgtcggcca acaaccatgt gatctgcttt ggatccggcg
      481 agcacagcat cttcatgacc caaatccagt tggagcacat caggaaattg gcctttattc
      541 cggataagat cagctcccta ctgttggatc ctcacgagca gggggagggg gaggaggcag
      601 acacgaaggc ggaagaggag gcgaagaaga cgcacatcca gttcaagaaa aaaccctttg
      661 ttcaggcgct taaggatatt tgcggacgca tcgacaggga tctcgacttt cggctgtccc
      721 aaaaaaggga tcaggaaggg gaacaggaac aggaatcgga acctatcctt ggctcagaag
      781 ccataacatc gccggtgttt gttgaagaca acgacggaga ggatgctcat ggcttggagc
      841 actttgtaga cgaaacggaa gaggaagaaa acgaatcgct ggatgatagt gcgagcctgc
      901 cgtcgatcac caggggatcc tggccctggc tggcggccat ctatgtgaac aacctgacct
      961 ccttggactt ccagtgcggc ggaaccctcg tctcggggcg cgtggtcatc agctcggcgc
     1021 actgcttcaa gttgttcaac aagcgcttca catccaacga ggtcctcgtc ttcttgggcc
     1081 ggcataatct caagaactgg aacgaggagg gctcattggc ggcccccgtg gacggcattt
     1141 acatccatcc cgacttcaac agtcagctga gcagctacga tgcggatatc gccgtgatca
     1201 tgctcaagga cgaagttcga ttcaacacct tcattcgccc cgcttgcctg tggtccggtt
     1261 ccagcaaggc ggagtacatt gtaggcgagc agggcatcgt cattggctgg agctttgaca
     1321 gagcgaacag gacgcaggat cagaagctgt cgccggtggc tctggggggt aagaaatcca
     1381 gcgattcgca cagtgccccc aaggtggtga aggctccggt tgtcgggaat gccgagtgct
     1441 ttcgggctaa tgcccacttt cgcagcctct cctccaaccg aactttttgc gccggcatcc
     1501 acacggagga gcgggatcgc catcagcaga tcagtgccag catttacaca ggcatttcgg
     1561 gagccgggct ttttatccgg cgtaacaatc gctggatgct gcgcggcaca gtgtcagctg
     1621 ccctgcccgc cgttgaatcg ccagaaccgg gttacgtttg ctgtagaagc cagtacatta
     1681 tatatgctga cgtggccaag ttcctcgatt ggatcacggc cttcgtaatt taa