Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396180 360 bp mRNA linear INV 09-DEC-2024 (LOC123003510), mRNA. ACCESSION XM_044396180 VERSION XM_044396180.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 10% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..360 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..360 /gene="LOC123003510" /note="protein new-glue 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:123003510" CDS 1..360 /gene="LOC123003510" /codon_start=1 /product="protein new-glue 1-like" /protein_id="XP_044252115.1" /db_xref="GeneID:123003510" /translation="MKITPLLVLLATFLGCAMIRQSEGASSTTTTSASATTTTAASAT TSASAATTTTAASDSTTTTTESSSLVASGTKKQVIRHEKRKRHRPRKIRRTKRRGYGG SRNGKGRKGRKGRRSDD" ORIGIN 1 atgaagatca ccccgctcct cgtgctcctc gccaccttcc tcggctgtgc tatgatccgc 61 cagtcggagg gcgcctccag caccaccacc acctccgcct cggccaccac caccactgcc 121 gcctccgcaa ccacctccgc ctcggccgcc accaccacca ctgccgcttc ggactccacc 181 acgacaacca ctgaatcatc atcactagtc gcatctggca caaaaaagca ggtcataaga 241 catgaaaaac gtaagcgcca taggcccaga aagatcaggc gaactaaaag gaggggatac 301 ggcggaagtc gcaacggtaa aggacgcaag gggcgcaagg gccgcaggtc cgacgactga