PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_044396161             663 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108065466), mRNA.
ACCESSION   XM_044396161
VERSION     XM_044396161.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..663
                     /gene="LOC108065466"
                     /note="uncharacterized LOC108065466; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108065466"
     CDS             1..663
                     /gene="LOC108065466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044252096.1"
                     /db_xref="GeneID:108065466"
                     /translation="MLQFASYFLGVLIILNLRPSLAAFQEPEIQDKLDGIKESLKTMI
                     TKEDFETKLQDLQNQLDDQFLALQNSSQDILNKLPQKKLSRNNLKHIPPKFEQIDSRY
                     FYIENNEIQDWPTAGETCRQMGGYLAAIQNESELNALKVRLATNSYYWLGIHDREEKG
                     EFVSLATGKAAKFLKWHIGYPRNYTQVQGEPIVLQNEIIEELDESEEEEKEVLALFSG
                     AC"
     misc_feature    298..>552
                     /gene="LOC108065466"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgctgcagt ttgcatccta ttttttgggc gtccttataa tccttaattt gcgtccatcc
       61 ttggccgctt tccaggaacc cgaaatccag gataaattgg atggtattaa agagtccctc
      121 aagacgatga taacgaagga ggacttcgag acaaaactgc aggaccttca gaaccagctg
      181 gatgaccagt ttttggcgct gcagaacagt tcacaggata ttttgaacaa actgccgcag
      241 aagaagctct ctaggaataa tctaaaacat ataccaccaa agttcgagca aatcgattcg
      301 agatactttt atattgaaaa caacgaaatt caggattggc ccacagctgg agagacctgt
      361 cgccagatgg gcggctattt ggcagcgatc caaaacgaat cggaactgaa tgcactcaaa
      421 gtgagactcg ccacaaactc atattactgg ctgggcattc acgatcgcga ggagaagggc
      481 gaatttgtat cattggccac cggaaaggca gccaaatttc tgaaatggca catcggatat
      541 cccagaaatt acacacaagt tcaaggcgag ccaatagtgt tgcaaaatga aattattgag
      601 gagctggatg agagcgagga ggaggagaag gaggtcctgg cgcttttttc cggagcttgc
      661 taa