PREDICTED: Drosophila takahashii la costa (lcs), mRNA.

LOCUS       XM_044396156             441 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_044396156
VERSION     XM_044396156.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..441
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..441
                     /gene="lcs"
                     /note="la costa; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:123003505"
     CDS             1..441
                     /gene="lcs"
                     /codon_start=1
                     /product="cuticle collagen 7"
                     /protein_id="XP_044252091.1"
                     /db_xref="GeneID:123003505"
                     /translation="MRALILVTLVVVVAVASAQGPGGPWGPRGPGGPGRGGPGGRGPP
                     GRGPGGPGGPGGPGRGPGGPGGPGGPGGPGGPGGPGGPGGPGPWGPPPCNRTTTTEAS
                     TSSSSTTPSSTTASSTTVSSTTASSTTESSTESSTESSTASSSA"
ORIGIN      
        1 atgcgtgccc ttattcttgt taccctggtg gttgtggtcg ctgtggcctc cgcccaagga
       61 cccggaggtc cgtggggacc acgtggaccc ggtggtccag gacgcggcgg accaggtggt
      121 cgaggacccc caggacgtgg accaggagga ccaggtggcc ctggaggtcc aggacgcggc
      181 ccaggaggtc ctggaggtcc tggaggacca ggaggtccgg gaggtccagg aggtccggga
      241 ggaccaggag gtcctggacc atggggacca ccaccatgca accgaaccac caccacagag
      301 gcctctacaa gctcttcctc caccactcct tcctccacca ccgcttcctc caccaccgtc
      361 tcctccacca ccgcctcctc caccacggag tcctccaccg aatcctccac ggaatcctcc
      421 acggcttcct cgtcggcata a