Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii trichohyalin-like (LOC123003502),


LOCUS       XM_044396134            1236 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_044396134
VERSION     XM_044396134.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1236
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1236
                     /gene="LOC123003502"
                     /note="trichohyalin-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:123003502"
     CDS             1..1236
                     /gene="LOC123003502"
                     /codon_start=1
                     /product="trichohyalin-like"
                     /protein_id="XP_044252069.1"
                     /db_xref="GeneID:123003502"
                     /translation="MPRVSSLSQEQRRQAAVRRSRSQYAQNASEIRTRNAQHIALARA
                     SNLEVAEVARSQNSAARSQRRRSERIRASERLRNTANRATWRSIEENRGPERARDAAA
                     HSSARSNSEDRRRHQVQNTADHATWRSIEANRGPERVRDAAARAIVGSDSEERRREQS
                     RNTADHATCRSTEENRGTERARDAAAHARVRSNSEERRRQQVQNTAAHAITRSDSEER
                     RRQQVQNTADHATWRSIDENRGPERVRDAAAHRITRNNPIARTQQQRTNTVHHRETRL
                     QRRLREQQIQEMAEERLLTYRSNSQNRQAESSRQSQRNIAATAQLSEDEREDQRKRQR
                     RRSRATAREQYLRNIKDGPTKFYTCCGGTWLPSQLCDTWLALSSTGSTTYPLTVIGSI
                     KWVLKKRYLSSQMNLTEKL"
     misc_feature    91..>768
                     /gene="LOC123003502"
                     /note="transcription termination factor Rho; Provisional;
                     Region: PRK12678"
                     /db_xref="CDD:237171"
ORIGIN      
        1 atgccgcgcg tatcttcttt atctcaagag cagcgccgcc aagctgcagt tagacgaagc
       61 cgatcccaat atgctcaaaa tgcgtctgaa ataaggaccc gcaatgcgca gcacattgcc
      121 ttggcccgcg caagtaattt agaggtagca gaagtagctc gctcgcaaaa ttccgctgct
      181 cgctctcaaa gaaggagaag tgaaaggatt cgagccagcg aacgattgag gaatactgcc
      241 aatcgcgcta cctggagatc gatcgaggaa aatcgaggac cggaacgcgc acgggacgct
      301 gcagcccact ccagcgccag gtcgaattcg gaagatcgac gacgacatca ggtgcaaaat
      361 actgctgacc atgctacctg gagatcgatc gaggcgaatc ggggtcccga acgcgttcgg
      421 gatgctgctg ctcgcgcaat agttgggtcg gattccgagg agcgacgacg agagcagtcg
      481 cgaaatactg ctgaccatgc tacctgtaga tcgacagagg aaaatcgagg aaccgagcgc
      541 gcacgggacg ctgcagccca cgccagggtc aggtcgaatt cggaagagcg acgacgacag
      601 caagtgcaga atactgcagc gcacgcaatc accaggtcgg attccgagga gcgacgacga
      661 cagcaggtgc aaaatactgc tgaccatgct acctggagat cgatcgacga gaatcgaggt
      721 cccgaacgcg ttcgggacgc tgcagctcac aggatcacaa ggaacaaccc catcgctagg
      781 acacagcagc aaaggaccaa cacagtgcat catcgggaaa ctcgtcttca gaggagactt
      841 cgggagcagc aaattcagga aatggctgag gagcgactat tgacttatag gtccaattca
      901 caaaatcgac aggcggaatc ttcaaggcag tcacagcgca atattgctgc aacagcacaa
      961 ctttcggagg atgaacgaga ggatcaacgg aaacgccagc gacggaggag tcgagctact
     1021 gcgagggaac aatatctacg taacattaag gacggaccaa caaagtttta tacgtgctgt
     1081 ggaggaacgt ggcttccatc tcagctgtgc gatacttggt tagcactgag ctctacagga
     1141 agcacaacat atcctttgac ggtgattggc tcaatcaaat gggtgctgaa gaagagatac
     1201 ctttcatcgc agatgaatct gaccgagaag ttgtag