Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396134 1236 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_044396134 VERSION XM_044396134.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1236 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1236 /gene="LOC123003502" /note="trichohyalin-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:123003502" CDS 1..1236 /gene="LOC123003502" /codon_start=1 /product="trichohyalin-like" /protein_id="XP_044252069.1" /db_xref="GeneID:123003502" /translation="MPRVSSLSQEQRRQAAVRRSRSQYAQNASEIRTRNAQHIALARA SNLEVAEVARSQNSAARSQRRRSERIRASERLRNTANRATWRSIEENRGPERARDAAA HSSARSNSEDRRRHQVQNTADHATWRSIEANRGPERVRDAAARAIVGSDSEERRREQS RNTADHATCRSTEENRGTERARDAAAHARVRSNSEERRRQQVQNTAAHAITRSDSEER RRQQVQNTADHATWRSIDENRGPERVRDAAAHRITRNNPIARTQQQRTNTVHHRETRL QRRLREQQIQEMAEERLLTYRSNSQNRQAESSRQSQRNIAATAQLSEDEREDQRKRQR RRSRATAREQYLRNIKDGPTKFYTCCGGTWLPSQLCDTWLALSSTGSTTYPLTVIGSI KWVLKKRYLSSQMNLTEKL" misc_feature 91..>768 /gene="LOC123003502" /note="transcription termination factor Rho; Provisional; Region: PRK12678" /db_xref="CDD:237171" ORIGIN 1 atgccgcgcg tatcttcttt atctcaagag cagcgccgcc aagctgcagt tagacgaagc 61 cgatcccaat atgctcaaaa tgcgtctgaa ataaggaccc gcaatgcgca gcacattgcc 121 ttggcccgcg caagtaattt agaggtagca gaagtagctc gctcgcaaaa ttccgctgct 181 cgctctcaaa gaaggagaag tgaaaggatt cgagccagcg aacgattgag gaatactgcc 241 aatcgcgcta cctggagatc gatcgaggaa aatcgaggac cggaacgcgc acgggacgct 301 gcagcccact ccagcgccag gtcgaattcg gaagatcgac gacgacatca ggtgcaaaat 361 actgctgacc atgctacctg gagatcgatc gaggcgaatc ggggtcccga acgcgttcgg 421 gatgctgctg ctcgcgcaat agttgggtcg gattccgagg agcgacgacg agagcagtcg 481 cgaaatactg ctgaccatgc tacctgtaga tcgacagagg aaaatcgagg aaccgagcgc 541 gcacgggacg ctgcagccca cgccagggtc aggtcgaatt cggaagagcg acgacgacag 601 caagtgcaga atactgcagc gcacgcaatc accaggtcgg attccgagga gcgacgacga 661 cagcaggtgc aaaatactgc tgaccatgct acctggagat cgatcgacga gaatcgaggt 721 cccgaacgcg ttcgggacgc tgcagctcac aggatcacaa ggaacaaccc catcgctagg 781 acacagcagc aaaggaccaa cacagtgcat catcgggaaa ctcgtcttca gaggagactt 841 cgggagcagc aaattcagga aatggctgag gagcgactat tgacttatag gtccaattca 901 caaaatcgac aggcggaatc ttcaaggcag tcacagcgca atattgctgc aacagcacaa 961 ctttcggagg atgaacgaga ggatcaacgg aaacgccagc gacggaggag tcgagctact 1021 gcgagggaac aatatctacg taacattaag gacggaccaa caaagtttta tacgtgctgt 1081 ggaggaacgt ggcttccatc tcagctgtgc gatacttggt tagcactgag ctctacagga 1141 agcacaacat atcctttgac ggtgattggc tcaatcaaat gggtgctgaa gaagagatac 1201 ctttcatcgc agatgaatct gaccgagaag ttgtag