Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044396123             327 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108064051), transcript variant X2, mRNA.
ACCESSION   XM_044396123
VERSION     XM_044396123.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..327
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..327
                     /gene="LOC108064051"
                     /note="uncharacterized LOC108064051; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108064051"
     CDS             1..327
                     /gene="LOC108064051"
                     /codon_start=1
                     /product="uncharacterized protein isoform X2"
                     /protein_id="XP_044252058.1"
                     /db_xref="GeneID:108064051"
                     /translation="MRHAVILVFVCGLLIAFASAGLLGGGGGGGGGYGGGGSGGGGGY
                     GSGGGQGGWQKNGGGGGGGGQGGYGGGNQGGGHGGGGQGGWQKNGGGGANHPPARADF
                     ILCSMA"
ORIGIN      
        1 atgcgtcacg cggttatcct tgtttttgtg tgcggtctct tgatcgcctt cgcctcagcc
       61 ggtttgctgg gcgggggagg cggtggtggt ggtggctacg gcggtggtgg cagtggtgga
      121 ggtggtggct acggtagtgg aggcggtcaa ggtggctggc agaagaacgg aggaggaggc
      181 ggcggtggcg gccagggagg ctacggcggc ggtaaccaag gcggtggcca tggaggcggt
      241 ggccagggag gctggcagaa gaacggagga ggcggcgcta atcacccccc ggctcgtgct
      301 gacttcatat tgtgttccat ggcatag