Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396123 327 bp mRNA linear INV 09-DEC-2024 (LOC108064051), transcript variant X2, mRNA. ACCESSION XM_044396123 VERSION XM_044396123.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..327 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..327 /gene="LOC108064051" /note="uncharacterized LOC108064051; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108064051" CDS 1..327 /gene="LOC108064051" /codon_start=1 /product="uncharacterized protein isoform X2" /protein_id="XP_044252058.1" /db_xref="GeneID:108064051" /translation="MRHAVILVFVCGLLIAFASAGLLGGGGGGGGGYGGGGSGGGGGY GSGGGQGGWQKNGGGGGGGGQGGYGGGNQGGGHGGGGQGGWQKNGGGGANHPPARADF ILCSMA" ORIGIN 1 atgcgtcacg cggttatcct tgtttttgtg tgcggtctct tgatcgcctt cgcctcagcc 61 ggtttgctgg gcgggggagg cggtggtggt ggtggctacg gcggtggtgg cagtggtgga 121 ggtggtggct acggtagtgg aggcggtcaa ggtggctggc agaagaacgg aggaggaggc 181 ggcggtggcg gccagggagg ctacggcggc ggtaaccaag gcggtggcca tggaggcggt 241 ggccagggag gctggcagaa gaacggagga ggcggcgcta atcacccccc ggctcgtgct 301 gacttcatat tgtgttccat ggcatag