Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044396116            1465 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123003495), mRNA.
ACCESSION   XM_044396116
VERSION     XM_044396116.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044396116.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1465
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1465
                     /gene="LOC123003495"
                     /note="uncharacterized LOC123003495; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:123003495"
     CDS             66..656
                     /gene="LOC123003495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044252051.1"
                     /db_xref="GeneID:123003495"
                     /translation="MSRPTVRERKPRIRSNPKLVGVQGRKLSSSKSSDSEPSGSRKYL
                     KKSLHKTNSNRDSIETLGAMPSASSVQFPNCSSSDNGYDAGADTDDAGDDGMDEAAMM
                     QLRSRKRPHIPLNSFVLPEPIPSHRSGGFLRLLARSLHQCSMGIAAGFGLSRQQAAWY
                     KNCWQSPGSQPKGVHLMGNFSKIPVKSRKIESSTTL"
     polyA_site      1465
                     /gene="LOC123003495"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatgtcatat ctgagcaatc aaaattccaa aataatcaaa attaaacctg aaactttggg
       61 ggaaaatgtc cagaccaact gttagggaac gtaagcccag gattaggagt aatcccaaac
      121 tggtgggagt ccaaggcaga aaactctcga gttccaagag ttccgacagc gagccgagtg
      181 gttcgaggaa atatctaaag aagagtttgc acaaaaccaa tagcaacagg gattccattg
      241 aaactctggg tgcgatgccc agtgcatcca gtgttcagtt tccaaactgc agttcctcgg
      301 ataatggcta tgatgcgggt gcggataccg atgatgccgg cgacgatgga atggatgagg
      361 ccgccatgat gcaattgagg tctcgaaagc ggccccatat ccccttaaac tccttcgtcc
      421 ttccggaacc gattccttcc catcgatctg gtggattcct tcgtctcctg gcccgcagcc
      481 tgcatcagtg ttcaatgggg atcgccgccg gctttggatt gagccgacag caggccgcct
      541 ggtacaagaa ctgctggcaa agtccgggct cccagccaaa gggtgtccat ctaatgggaa
      601 atttttccaa gatcccggtt aaatcgcgaa aaattgaaag ttcaaccact ttgtaaaatc
      661 ttttgtattc taaaaactta ttcttccaat gattaatgcc gatttgtgta aggaatatga
      721 actgtgacat agaaaaggaa aggtcttaat agtaaaaatt aaccaaaaat cgaaattttg
      781 atatttttcg attatttatt aaaaatatcg atattatcga aacaatattg ggaaaatatc
      841 gatcacttaa tagggttttc tttcaaattg ttctcttaac tatcgttttg agtcattatc
      901 gatggcttca gatttcccaa tcgattattc acttcaaata ctatttcatt ttgtgagatt
      961 tctacgattg ctctacaaag aaaaaaaacc gacgcatttt ttgaattgta ggaagtcaag
     1021 ccgagcgaat gaatcaattt gttgagactt cccccgccac aaagtggact ctaaagccgc
     1081 aacaaatcga ttcatttgcc gatgattgac atgacaaagc agaacagaag ttgaataaca
     1141 ttttgatacg atcataatgc gcataattgc tatacgccaa cgcaccaatg gatacagata
     1201 caatccaaat atccgagccc agccaaagtt tggccagata acattattgt ttgccaagca
     1261 ctaaagctca ttaaagtgtg caattatttg atctgaagac cactattcgg tgcgatggct
     1321 gtgatcaatg gccaattgag tacgtgaagc caacactcag ttccacaaaa aaaaagaaaa
     1381 gaaatacttg atgaagtcag gaagttgatc ggaaatatca gcgcaatgat gatggaacag
     1441 gggttcatgg atcaagatta tcaaa