Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Gustatory receptor 10a (Gr10a),


LOCUS       XM_044396111            1218 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_044396111
VERSION     XM_044396111.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044396111.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1218
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1218
                     /gene="Gr10a"
                     /note="Gustatory receptor 10a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:123003493"
     CDS             1..1218
                     /gene="Gr10a"
                     /codon_start=1
                     /product="gustatory receptor 10a"
                     /protein_id="XP_044252046.1"
                     /db_xref="GeneID:123003493"
                     /translation="MTSPDDERSFWERHEFKFYQYGHVYALIYGQVVIDYVPQRALRR
                     GIKVLLILYGHLFSLLLIVVLPGYFCYHFRTLTDTLDRRLQLLFYVSFANTAIKYATV
                     IVTYVANTVHFEAINQRCTLQRMHLEREFADAPQEPKKPFEFLMYFKFCLINLMMAVQ
                     VCGIFAQYGDSQNQVRVHFAIYAFVLWNYTENMADYCYWINASVLKYYRQFNLQLDSL
                     RREVNALRPGGGMLLHRCCELSDRLEELRRRCREIHGLQRESFRMHQFQLIGLMLSTL
                     INNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVTLVNEHIKLELEGVA
                     LTVRRFAEPPARDERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFI
                     TLVQFDLYLRKRS"
     misc_feature    67..1197
                     /gene="Gr10a"
                     /note="7tm Chemosensory receptor; Region: 7tm_7;
                     pfam08395"
                     /db_xref="CDD:462463"
ORIGIN      
        1 atgacatcgc ccgatgatga gcggagtttc tgggagcggc acgagttcaa gttctaccag
       61 tacggccatg tgtacgccct gatctacggc caggtggtga tcgactatgt gccccagagg
      121 gctctcaggc ggggcatcaa ggtgctcctg atcctctacg gtcacctgtt tagcctgctg
      181 ctgattgtcg tgctgcccgg ctacttttgc tatcactttc gcaccctaac cgacactctg
      241 gatcgccgac tgcagctgct gttctacgtg agctttgcca acacggccat caaatatgcc
      301 accgtgattg tgacctatgt ggctaatacc gtgcactttg aggccatcaa tcagcggtgc
      361 acgctgcaga ggatgcatct cgaaagagaa ttcgccgatg ccccgcagga gccgaagaaa
      421 cccttcgagt tcctcatgta cttcaagttc tgcctgatca acctgatgat ggcggtccag
      481 gtgtgcggga tctttgccca atatggcgat tcacagaacc aggtgcgcgt ccacttcgcc
      541 atctacgcct tcgtgctgtg gaactacacg gagaacatgg ccgactattg ctattggatc
      601 aatgcctcgg tgctcaagta ctacaggcag ttcaatctcc agctggattc gctgaggcgg
      661 gaggtgaatg ccctgcgtcc gggtggcgga atgctcctcc atcgctgctg cgagctgagc
      721 gatcgcctgg aggagctgcg tcggcggtgc cgcgagatcc acggcctgca gagggagagc
      781 ttccgcatgc accagttcca gctgatcggg ctgatgctga gcaccctgat caacaacctg
      841 accaacttct acaccctctt ccacatgctg gccaagcagt cgctggagga ggtcagctac
      901 ccggtggtgg tgggatcggt ctatgccacc ggcttctaca tagacaccta catcgtgacc
      961 ctggtcaacg agcacatcaa gctggagctg gagggcgtcg cgctgaccgt gaggcggttc
     1021 gcagagccac cggcaaggga cgagcggctg accagggaga tagaacacct atcgctggag
     1081 ctactcaact accaaccgcc gatgctctgc ggtcttttgc acctggaccg ccgattggtg
     1141 tacctcattg cagttacagc cttctcctac ttcataaccc tggtgcagtt tgatctctat
     1201 ctgcgcaaga ggtcctag