PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_044396104             384 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123003490), mRNA.
ACCESSION   XM_044396104
VERSION     XM_044396104.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 37% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..384
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..384
                     /gene="LOC123003490"
                     /note="uncharacterized LOC123003490; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:123003490"
     CDS             1..384
                     /gene="LOC123003490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044252039.1"
                     /db_xref="GeneID:123003490"
                     /translation="MDVDANVDVDVDADMHVKRLEWNGAKSVPGKRAQSSTDSGTNIV
                     HIHIHTDQRRQGHGRFTQLMDLLPLGSTKLATRSEGPSINPSPNPNQCQTSISSSLGS
                     PNLSFHSEELLLDMETGEEFHELHR"
ORIGIN      
        1 atggatgtgg acgcgaatgt ggatgtggat gtggatgcgg acatgcatgt gaagcgattg
       61 gagtggaatg gagcgaaatc agttccaggc aaacgagccc aaagttccac cgacagtggc
      121 accaacatcg tccacatcca cattcacacc gaccaaaggc gacagggaca tggccgcttc
      181 acccagctta tggacctcct gccactgggc tccacgaaac tggccaccag atccgagggg
      241 ccctccataa atccgagtcc caatccaaat cagtgtcaaa catctatatc atcgtcgctg
      301 ggcagcccga atctcagctt ccacagcgag gagctgctcc tggacatgga gaccggcgag
      361 gagttccatg agctgcacag gtag