Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii anionic trypsin-2 (LOC108063800),


LOCUS       XM_044396099            2124 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X1, mRNA.
ACCESSION   XM_044396099
VERSION     XM_044396099.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044396099.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2124
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2124
                     /gene="LOC108063800"
                     /note="anionic trypsin-2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108063800"
     CDS             52..1029
                     /gene="LOC108063800"
                     /codon_start=1
                     /product="anionic trypsin-2"
                     /protein_id="XP_044252034.1"
                     /db_xref="GeneID:108063800"
                     /translation="MCRLSKFVVCLLLLISVNAELVPESNTTAQLHSLPLQEGAAKDP
                     DSDPSPSDFQFLITGGYRPKNNNLVKYVVSLRLGKSKKFFGDNHFCAGAIFSPRAILT
                     AAHCLFSGKRRLMPKKISVIAGTPKRLVKTGSTQTVVAKKLVPHPKYKKGKSQKYDIG
                     IVLTKEDITLGGSADSIALYHKAPVAGVQCTIVGWGTVIQYGPLPDEVINGDVRILPD
                     TFCRKLMGWSSEGMLCANDATNTEVDSCQGDSGGPLICDNKVTGIVSFGTGCGEPDTA
                     GIYTDVYHFREWINENSCPRAIYPRRALLILVSCVLAERHLIEHSTGCY"
     misc_feature    220..927
                     /gene="LOC108063800"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    220..222
                     /gene="LOC108063800"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(364..366,523..525,799..801)
                     /gene="LOC108063800"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(781..783,844..846,850..852)
                     /gene="LOC108063800"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 gttgttaagt gtcacatttt ttgtgtaggg cctattccct acccatctaa aatgtgtcgt
       61 ctatccaaat ttgttgtgtg ccttctgctg ctgatctctg ttaacgccga gttggtcccc
      121 gaatcgaaca caacagcaca gctgcattcg ctgccgctgc aggaaggtgc cgctaaggat
      181 cccgattccg atcccagccc ctcggacttt cagtttctga tcacgggcgg ctatcggccg
      241 aagaacaaca acctggtcaa gtacgtcgtc tcgctgcgat tgggcaagtc caagaagttc
      301 ttcggcgaca accacttttg cgcgggagcg atcttcagtc cacgggccat tctaaccgca
      361 gcccactgcc tgtttagtgg caaacgcagg ctaatgccca agaagatatc ggtcatcgcc
      421 gggacgccca agaggctggt gaaaaccggc tccacacaga ctgtcgtcgc caagaagctg
      481 gtgccgcatc ccaagtacaa gaagggcaag tcgcagaagt acgacatcgg aatagtgctg
      541 accaaggagg atatcacgct gggcggctcg gcggacagca tagctctgta ccacaaggct
      601 ccggtggccg gggtgcagtg caccatcgtt ggctggggca cagtcattca gtacgggcca
      661 ctgccggatg aggtgatcaa cggcgatgtg aggatcctgc cggacacctt ctgcagaaag
      721 ctgatgggct ggagcagcga gggcatgctg tgcgccaacg atgcgaccaa caccgaggtg
      781 gacagctgcc agggcgactc gggggggccg ctcatctgtg acaacaaggt gaccggcatc
      841 gtgtccttcg gcacgggctg cggcgaaccc gacacggccg gcatctacac cgatgtctat
      901 cactttcgcg aatggatcaa cgagaactcc tgcccacggg ccatttatcc ccggcgcgcg
      961 ctgttgattc tggtcagctg tgtcctagcc gaaagacatc tcattgaaca ttcaacaggc
     1021 tgctactaag ttatccagtt gtccagctat ccagctatcc agtcggcctg caaacctccg
     1081 agcctgcagg cgacaaacca aaattgacta aaaccagcgg gcaaggcctg tcatccgtgg
     1141 atgtggacgt ggatgtgaag gcaggtagcg aggccgaatg gcgaatggcg aaatgtggtg
     1201 ccagccgcgc cattacccgc gctcacgtgc acacacacgg atggatagat ggtgggtggt
     1261 ggatggtggg ttggtgggac aacggtttat ggttacgccg atgcagatcc acatccactg
     1321 tttgtgacag caattatcgc atcacgacca ggggagtcgg aatcagaatc agaatcctct
     1381 cctccaacca accaaccaac cacacacaca cacacacact cggcatatca agcagcgaag
     1441 acaatatgca acaattcgcg atggttaatt ttgggcgctc gtcgccaact gttgattaga
     1501 ccaattaggg gcaacgccaa ttaggtggcc tggtccagat tataggacca aaacggcaac
     1561 agtaaaatgg acttttgcgg atgcaaggtg accctggact tgctccaggc gaatctcgga
     1621 tagaaatcag tgcggaagca tgttgatttg atatcagagc aatgcaatta gtaatcgcac
     1681 acgcacactc caatcacttg cgcatatagc acgattgaaa aggcaaatgg aggagtggaa
     1741 ctggggacct cagcaacaca agtcacgaac gtgttttgtc cttaggaagg gatgctccat
     1801 gctccatgct ccataagctc caggatccaa gcaaggccat tgtggaacag gggacacacg
     1861 acgacaggca agcggcaaaa caatgttgaa ttgatgtggg actccgaggg accagggacc
     1921 aacacaaacc aacccgaacc gaccccatct cacccagaag caggcacaga ggcccaccga
     1981 agcccagaga cccagacgac acatatttac agacattcag gcattcgcaa tcgcaatcag
     2041 gtttgtcatt tcacagtcgt attgtgtgct gttcaagtgt tcataatgaa tttaatcgcg
     2101 tatgtttatt gctcactttg ccat