Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396099 2124 bp mRNA linear INV 09-DEC-2024 transcript variant X1, mRNA. ACCESSION XM_044396099 VERSION XM_044396099.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044396099.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2124 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..2124 /gene="LOC108063800" /note="anionic trypsin-2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108063800" CDS 52..1029 /gene="LOC108063800" /codon_start=1 /product="anionic trypsin-2" /protein_id="XP_044252034.1" /db_xref="GeneID:108063800" /translation="MCRLSKFVVCLLLLISVNAELVPESNTTAQLHSLPLQEGAAKDP DSDPSPSDFQFLITGGYRPKNNNLVKYVVSLRLGKSKKFFGDNHFCAGAIFSPRAILT AAHCLFSGKRRLMPKKISVIAGTPKRLVKTGSTQTVVAKKLVPHPKYKKGKSQKYDIG IVLTKEDITLGGSADSIALYHKAPVAGVQCTIVGWGTVIQYGPLPDEVINGDVRILPD TFCRKLMGWSSEGMLCANDATNTEVDSCQGDSGGPLICDNKVTGIVSFGTGCGEPDTA GIYTDVYHFREWINENSCPRAIYPRRALLILVSCVLAERHLIEHSTGCY" misc_feature 220..927 /gene="LOC108063800" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 220..222 /gene="LOC108063800" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(364..366,523..525,799..801) /gene="LOC108063800" /note="active site" /db_xref="CDD:238113" misc_feature order(781..783,844..846,850..852) /gene="LOC108063800" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" ORIGIN 1 gttgttaagt gtcacatttt ttgtgtaggg cctattccct acccatctaa aatgtgtcgt 61 ctatccaaat ttgttgtgtg ccttctgctg ctgatctctg ttaacgccga gttggtcccc 121 gaatcgaaca caacagcaca gctgcattcg ctgccgctgc aggaaggtgc cgctaaggat 181 cccgattccg atcccagccc ctcggacttt cagtttctga tcacgggcgg ctatcggccg 241 aagaacaaca acctggtcaa gtacgtcgtc tcgctgcgat tgggcaagtc caagaagttc 301 ttcggcgaca accacttttg cgcgggagcg atcttcagtc cacgggccat tctaaccgca 361 gcccactgcc tgtttagtgg caaacgcagg ctaatgccca agaagatatc ggtcatcgcc 421 gggacgccca agaggctggt gaaaaccggc tccacacaga ctgtcgtcgc caagaagctg 481 gtgccgcatc ccaagtacaa gaagggcaag tcgcagaagt acgacatcgg aatagtgctg 541 accaaggagg atatcacgct gggcggctcg gcggacagca tagctctgta ccacaaggct 601 ccggtggccg gggtgcagtg caccatcgtt ggctggggca cagtcattca gtacgggcca 661 ctgccggatg aggtgatcaa cggcgatgtg aggatcctgc cggacacctt ctgcagaaag 721 ctgatgggct ggagcagcga gggcatgctg tgcgccaacg atgcgaccaa caccgaggtg 781 gacagctgcc agggcgactc gggggggccg ctcatctgtg acaacaaggt gaccggcatc 841 gtgtccttcg gcacgggctg cggcgaaccc gacacggccg gcatctacac cgatgtctat 901 cactttcgcg aatggatcaa cgagaactcc tgcccacggg ccatttatcc ccggcgcgcg 961 ctgttgattc tggtcagctg tgtcctagcc gaaagacatc tcattgaaca ttcaacaggc 1021 tgctactaag ttatccagtt gtccagctat ccagctatcc agtcggcctg caaacctccg 1081 agcctgcagg cgacaaacca aaattgacta aaaccagcgg gcaaggcctg tcatccgtgg 1141 atgtggacgt ggatgtgaag gcaggtagcg aggccgaatg gcgaatggcg aaatgtggtg 1201 ccagccgcgc cattacccgc gctcacgtgc acacacacgg atggatagat ggtgggtggt 1261 ggatggtggg ttggtgggac aacggtttat ggttacgccg atgcagatcc acatccactg 1321 tttgtgacag caattatcgc atcacgacca ggggagtcgg aatcagaatc agaatcctct 1381 cctccaacca accaaccaac cacacacaca cacacacact cggcatatca agcagcgaag 1441 acaatatgca acaattcgcg atggttaatt ttgggcgctc gtcgccaact gttgattaga 1501 ccaattaggg gcaacgccaa ttaggtggcc tggtccagat tataggacca aaacggcaac 1561 agtaaaatgg acttttgcgg atgcaaggtg accctggact tgctccaggc gaatctcgga 1621 tagaaatcag tgcggaagca tgttgatttg atatcagagc aatgcaatta gtaatcgcac 1681 acgcacactc caatcacttg cgcatatagc acgattgaaa aggcaaatgg aggagtggaa 1741 ctggggacct cagcaacaca agtcacgaac gtgttttgtc cttaggaagg gatgctccat 1801 gctccatgct ccataagctc caggatccaa gcaaggccat tgtggaacag gggacacacg 1861 acgacaggca agcggcaaaa caatgttgaa ttgatgtggg actccgaggg accagggacc 1921 aacacaaacc aacccgaacc gaccccatct cacccagaag caggcacaga ggcccaccga 1981 agcccagaga cccagacgac acatatttac agacattcag gcattcgcaa tcgcaatcag 2041 gtttgtcatt tcacagtcgt attgtgtgct gttcaagtgt tcataatgaa tttaatcgcg 2101 tatgtttatt gctcactttg ccat