Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_044396091           12053 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X40, mRNA.
ACCESSION   XM_044396091
VERSION     XM_044396091.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..12053
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..12053
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..11380
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X39"
                     /protein_id="XP_044252026.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSEFDEDPIEVALP
                     TDEVEGSGQDSGSCRGDATFQCRRSGKTICDEMRCDGSRDCPDAEDEEGCEVCNELQF
                     KCDNKCLPLNKRCDNRYDCEDQTDEAGCQRYEVEESQPQPQPQPQPEPEPEPEPEPEP
                     EPEPEPEPEEPITDNEQPEQNSECRATEFRCNNGDCIDIRKRCDHISDCSEGEDENEE
                     CRCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKNGQCVSS
                     TARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIFRCRDEG
                     PNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIPGQHVTV
                     NLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSCSLGLKC
                     QPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGHCIPK
                     SFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTPTIVWRL
                     NWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVR
                     SDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVSVELSPF
                     RQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSYGGNLRY
                     EVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPDGRKGTR
                     EDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEKCTCPPG
                     YVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPCPHAGAN
                     NFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSSCNVDGT
                     YNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSSWYRN
                     QVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNTLYWSLP
                     AAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPS
                     VANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASLRSVTLD
                     TATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPCECNGHS
                     KYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSRPPAPGN
                     QTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCKECYCSG
                     LTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKHTSYTPK
                     YWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRPDGHDNE
                     QEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVSTSISNVI
                     LESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPCDASNTE
                     SCGLVSGGNVECQCRPRWRGDRCREIETNEPTPEPDTSTDDPVRTQIIVSIARPEITI
                     LPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFNLQISDSGIYI
                     CQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEIVCEVEGNPPP
                     TVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREEKYVVVYVRSN
                     PPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRSLSASSPRNVV
                     VRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGILGDKPHILTL
                     EQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTIYGGRSENRGL
                     YSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCAAQGIPEPTVE
                     WVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGLATINVQEPTL
                     VRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPEGAVFAQPFRT
                     NTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGGDDNGDVDTRQ
                     PPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPHNAYTVRNTLV
                     IVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLTVELGQNLDVY
                     CQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCSATNQYGSRSK
                     NARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQFNWYREDGSP
                     LPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVLTVPAAPQNPI
                     YLPPVAPPRSPERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPL
                     SENVQQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVY
                     AKVGGNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSA
                     QYSDGETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLL
                     LFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDG
                     YIQVDDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRL
                     TLQGRTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDC
                     AIEGTQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAY
                     GTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLD
                     PVVVRSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGG
                     VDRSTVKINRDVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEY
                     EMPVALPSPKVAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQ
                     LSFNASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQ
                     DFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILD
                     TGDTRPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSA
                     AINGVNANVCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1250..1360
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1268..1270,1295..1297,1328..1333)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1307..1309,1316..1318,1328..1330,1346..1351)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1337..1351
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1367..1468
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1382..1384,1403..1405,1436..1441)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1415..1417,1424..1426,1436..1438,1454..1459)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1445..1459
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1625..1723
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1643..1645,1667..1669,1700..1705)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1679..1681,1688..1690,1700..1702,1718..1723)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1709..1723
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1739..1843
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1754..1756,1778..1780,1811..1816)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1790..1792,1799..1801,1811..1813,1829..1834)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1820..1834
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1859..1963
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1874..1876,1898..1900,1931..1936)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1910..1912,1919..1921,1931..1933,1949..1954)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1940..1954
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2006..2212
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    2306..2410
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2321..2323,2345..2347,2378..2383)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2357..2359,2366..2368,2378..2380,2396..2401)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2387..2401
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2426..2530
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2441..2443,2465..2467,2498..2503)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2477..2479,2486..2488,2498..2500,2516..2521)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2507..2521
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2555..2659
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2570..2572,2594..2596,2627..2632)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2606..2608,2615..2617,2627..2629,2645..2650)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2636..2650
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2711..2938
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    2720..2734
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:143220"
     misc_feature    2759..2773
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:143220"
     misc_feature    2828..2842
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:143220"
     misc_feature    2870..2887
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:143220"
     misc_feature    2912..2923
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:143220"
     misc_feature    3233..3625
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    3794..3955
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(3794..3796,3800..3802,3836..3838,3866..3868,
                     3872..3874,3899..3901)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    3974..4108
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    4328..4738
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <4739..4819
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    4841..4990
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(4844..4846,4850..4852,4871..4873,4892..4894,
                     4901..4903,4928..4930)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <5099..5191
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    5387..5791
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6068..6316
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6101..6115
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6149..6163
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6206..6220
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    6248..6265
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6293..6304
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <6395..6556
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    6647..6898
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6680..6694
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    6719..6733
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    6788..6802
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    6830..6847
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    6935..7177
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    6986..7000
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    7025..7039
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    7082..7096
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    7124..7141
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    7163..7174
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    7229..7459
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    7253..7267
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409543"
     misc_feature    7292..7306
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409543"
     misc_feature    7397..7414
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409543"
     misc_feature    7436..7447
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409543"
     misc_feature    7496..7759
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7526..7540
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409548"
     misc_feature    7565..7579
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409548"
     misc_feature    7697..7714
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409548"
     misc_feature    8132..8362
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8159..8173
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409541"
     misc_feature    8198..8212
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409541"
     misc_feature    8258..8272
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409541"
     misc_feature    8300..8317
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409541"
     misc_feature    8396..>8599
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8429..8443
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    8477..8500
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    8546..8560
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    8741..8947
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9035..9235
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9059..9073
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9098..9112
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9155..9169
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9197..9214
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409390"
     misc_feature    9299..9742
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    9809..9907
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    10049..10510
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    10670..10768
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    10793..11254
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      12053
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgaattc gatgaggatc ctatcgaagt
     1201 tgcattgccc acggatgagg tggagggctc cggccaagat tccggtagct gtcgcggcga
     1261 tgccaccttc cagtgtcgaa ggagtggaaa gactatttgc gatgaaatgc gatgcgatgg
     1321 atctcgcgat tgtcccgatg ccgaggacga ggaaggctgc gaggtttgca acgaacttca
     1381 gttcaagtgc gataacaagt gtctgccgct caataagcgc tgcgataatc gatacgattg
     1441 tgaggatcag acggacgagg ctggttgtca acggtacgaa gtagaagagt ctcagcctca
     1501 gccgcagccg caacctcagc ctgaaccgga acctgaacct gaacctgagc ctgagcctga
     1561 acctgaacca gaaccagaac ctgaagagcc tataacagac aatgaacagc ctgagcaaaa
     1621 ctcagaatgc cgggccaccg agttcagatg caacaatggg gactgcatcg atattagaaa
     1681 gcgttgcgat cacatttcgg actgtagcga aggcgaggac gagaacgagg agtgccgctg
     1741 ttacgcggat caattccgct gcaataatgg tgactgcatt gcggaatcgg ctcattgcga
     1801 tggaaatatc gattgtagcg accagtccga tgaactcgac tgcggaggag actcgcagtg
     1861 tctgcccaac caattccgct gcaagaatgg ccaatgtgtg agctctacag cgcgttgcaa
     1921 caagcgttcc gattgtttgg atggctccga tgagcagaat tgtgccaatg aacctaacaa
     1981 ctccggacgt ggaacgaacc aattgaaact caagacctat cccgacaacc aaatcattaa
     2041 ggagagtcgt gaggtcatct tccgttgccg tgacgaaggt cccaaccgcg ccaaggtcaa
     2101 gtggtcgcga cccggcggac gtcccctgcc ccccggtttc accgatcgca atggccgcct
     2161 ggagatcccc aacatcaggg tggaggatgc tggcgcctat gtctgcgagg ccgtgggcta
     2221 tgccaactat attcccggtc agcacgtcac cgtaaacctc aacgtcgagc gcttaaacga
     2281 acgcgaaatc cgtccggact cagcctgtac ggagtaccag gccacctgca tgaacggcga
     2341 gtgtatcgat aagtcgggca tctgcgatgg acatccggac tgttcggatg gctccgatga
     2401 gcacagctgc agtttgggtt tgaagtgtca gcccaaccag ttcatgtgct ccaattccaa
     2461 gtgtgtggat cgcacctggc gctgtgatgg cgagaacgac tgcggcgata actccgatga
     2521 gacctcttgc gatccggaac caagtgatgc tccgtgccga tacgacgaat tccagtgccg
     2581 cagcggtcat tgcattccca agagcttcca gtgcgactat atgaacgatt gtaccgatgg
     2641 taccgatgaa attggatgct cggtgccctc tccaatgacc ctacccgcac cctcgattgt
     2701 cgtgatggag tacgaggtcc tcgagctgac ctgcgtgggc accggcgtcc cgacgccgac
     2761 gatcgtgtgg cgtctcaact ggggccatgt gcccgagaag tgtgaatcga agagctacgg
     2821 cggaaccgga accctgcgct gtccgaacat gaggccccag gacagtggtg cctactcgtg
     2881 cgagttcatc aacacacgcg gcaccttcta tccgaaaacg aactcgattg tcaccgttac
     2941 gccggtgcgc tcggatgtct gcaaggccgg attcttcaat atgctggccc gcaagtcgga
     3001 ggaatgcgtc cagtgcttct gctttggcgt ttcgaccaac tgtgacagtg ccaatttgtt
     3061 cacctacgcc attcagccac cgatcctttc gcaccgcgtg gtcagcgttg aactcagtcc
     3121 gttccgtcaa attgtcatca atgaggctag tccgggtcag gatctgctca ccttgcacca
     3181 tggtgttcag ttcagggcat cgaacgtaca ctacaacggc cgggagacac cattcttggc
     3241 cctgcccgct gagtatatgg gcaaccagct gaagtcctat ggcggcaatc tgcgctacga
     3301 ggtcaggtac aatggcaacg gtagaccggt cagcggaccc gatgtcatca tcaccggcaa
     3361 cagtttcacg ctaacccatc gcgttcgcac tcatccgggt cagaacaaca gggtgactat
     3421 tcccttcctg ccgggaggct ggacgaagcc ggatggtcgc aagggaacgc gagaggacat
     3481 catgatgata ctggccaatg tggacaatat tctgattcga ctgggctacc tggatagcac
     3541 agctcgcgaa gtggatctga taaatatcgc cttggattcg gccggaagtg ccgatcaggg
     3601 attgggcagt gcctcgctcg tggagaagtg cacctgtccg cccggctatg ttggtgattc
     3661 gtgcgagtcc tgtgcctcgg gctatgttcg ccaggcccgc ggaccttggc tgggtcattg
     3721 tgtgcccttc accccggaac cgtgcccagc gggaacctac ggcaatcccc gacttggtgt
     3781 tccctgccag gagtgtccgt gcccccacgc gggcgccaat aactttgcca gcggctgcca
     3841 acagagtccc gatggcgatg tgatttgccg ctgcaacgaa ggctatgccg gcaagaggtg
     3901 cgagcactgc gcccagggtt accagggtaa tccgttggca ccgggaggag tctgtcgcaa
     3961 gatacccgat agttcgtgca atgtcgacgg cacctacaac atctacagca atggaacgtg
     4021 ccagtgcaag gatagcgtga ttggcgaaca gtgcgacacc tgcgcgccga agagtttcca
     4081 cctcaattcg ttcacctaca ccggttgcat cgagtgcttc tgcagtggag tgggcttgga
     4141 ttgtgacagt agttcgtggt atcgcaacca ggtcaccagc acctttggac gaacgcgcgt
     4201 caatcatgga ttcgccctga ttagcgacta tatgcgcaat accccggtaa cggtgcccgt
     4261 ttccatgtcc acccaggcca atgccttgag cttcgtggga tccgccgagc aggccggtaa
     4321 tacgctctac tggagtcttc ccgccgcctt cctgggcaac aagctgacct cgtacggagg
     4381 caagttgagc tacacgctca gctacagtcc cctgcccagc ggcattatgt cgcgcaacag
     4441 tgcccccgat gtggtgatca agagcggcga ggatctgagg ctcatccatt acaggaagtc
     4501 gcaggtcagt cccagtgtgg ccaacaccta tgccgtggag atcaaggaga gcgcatggca
     4561 gcgcggcgat gaactggtgc ctaaccgtga acacgtcctg atggccctca gcaatattac
     4621 ggccatctat atcaaggcca cgtacacgac tagcaccaag gaggcctcgc tgcgatcggt
     4681 cacattggat acggccacgg ccaccaatct gggcaccgca cgtgccgtcg aagtggagca
     4741 gtgccgctgt cccgagggct atttgggtct ctcctgcgag cagtgtgctc ctggctatac
     4801 gcgcgatccg gaggcaggaa tctatctggg tctctgcagg ccctgcgagt gcaatggaca
     4861 ttccaagtat tgcaacagtg agacaggcga atgcgaaagc tgttccgaca acaccgaagg
     4921 attcaattgt gaccgatgcg ccgccggcta tgtgggtgat gccacccgag gaacttcgta
     4981 cgactgtcaa tacgatgacg gcggctatcc gacgtcgcgt ccaccggcac cgggcaatca
     5041 gacggccgaa tgcctggtga attgccaaca ggagggaacc gccggttgcc gcggctacca
     5101 gtgcgagtgc aagaggaatg tggctggcga tcgatgcgat cagtgccgcc ccggaaccta
     5161 tggactgtcg gcccaaaatc cggacggttg caaggagtgc tactgctccg gactgaccaa
     5221 ccagtgccgc tcggcgtctc tctaccgcca gctgataccc gtggacttca tttcgacgcc
     5281 accattgata acagacgaat tcggcgacat catggatagg gataaccttg tgcccgacgt
     5341 gcccaggaat gtgtatacct acaagcacac ctcctacacg cccaagtact ggagcctgag
     5401 gggtagtgtg ctgggcaacc agctgttgtc gtacggcggc cgcttggagt acagcctgat
     5461 tgtggagtcc gttggccggg accatcgtgg caaggatgtg gtcctaattg gcaacggact
     5521 caagctgatc tggtcgcgac ccgatggcca tgacaacgag caggaatacc atgtgcgttt
     5581 gcatgaggac gagcagtgga cggttgagga tcgtggatcg gcacgacagg ccacgcgggc
     5641 cgacttcatg actgtgctgt cggatctgca gcacatcctg atcctggcca cacccaaggt
     5701 gcccacggtc agcacctcga ttagcaatgt catcctggag agttcgataa ccacgagagc
     5761 gcctggagct acgcatgcct ccgatatcga gttgtgccag tgtccatccg gttatacggg
     5821 cacttcctgt gagtcctgcg caccactgca ctaccgcgac gcctctggac gctgcagtca
     5881 gtgtccttgc gacgcttcca acacggaatc ctgcggcttg gtcagcggcg gtaacgtcga
     5941 atgccagtgc aggccacgct ggaggggtga tcgctgccgg gaaattgaaa ctaacgaacc
     6001 gactccggaa ccggatacca gtaccgatga tcccgtgcgc acccagatca tagtgtcgat
     6061 tgccaggcca gagattacca ttctgcccgt gggtggatcg ctgaccctca gctgtaccgg
     6121 tcgaatgcgc tggaccaata gcccagtgtt tgtgaactgg tacaagcagg gcagtcacct
     6181 gcccgaggga gtcgaggtgc aaggcggtaa tctgcagctg ttcaacctgc agatcagcga
     6241 ttctggaatc tacatctgcc aggccgtaag caacgagacc ggccacagct ttacggacca
     6301 cgtctccatc accgtttccc aggaggacca acgctcgccg gctcacattg tggatttgcc
     6361 caacgacgtg accttcgagg agtacgtaag caatgagatc gtctgcgagg tggagggcaa
     6421 cccaccaccc actgtcacct ggactcgcgt ggatggccat gcggacgccc aaagtacgcg
     6481 aacggacaac aatcggctgg tcttcgattc gccgaggaaa tcggacgagg gtcgctatcg
     6541 ctgccaggca gagaatagcc tgagtcggga ggagaagtac gtagtcgtgt atgtccggag
     6601 caatcctccc cagccgccgc cgcagcagga tcgtttgtac atcacaccgc aggaggtgaa
     6661 cggtgtggcc ggtgactcct tccagttgtc ctgccaattc accagcgctg cctctctgcg
     6721 ctacgattgg tcccacgatg gtcgctccct gtccgcgtcg tcaccccgaa atgttgtggt
     6781 ccgcggaaat gtcctggaag tccgcgatgc caacgttcgc gactccggca cctacacctg
     6841 tgtggccttc gacctgcgca cccgacgcaa cttcaccgag agcgcacggg tctacatcga
     6901 gcagcccaac gagccgggaa tccttggcga caagccgcat atcttgacct tggagcagaa
     6961 catcataatt gtgcaaggcg aggacttgag catcacatgt gaggcaagtg gaacgcccta
     7021 tccctcgatt aagtggacca aggtgcagga gaatctggcc gaaaatgtcc gcatcagtgg
     7081 caatgtgctc accatctacg gaggccgcag tgagaatcgt ggtctttact cctgcatcgc
     7141 cgagaactct cacggcagcg atcagtccag cacaagcatc gatattgaac cccgggagcg
     7201 gccgagtctt acgattgata cggccaccca aaaggtttcg gttggctccc aggcgtccct
     7261 ttactgtgcc gcccagggca ttcccgaacc gaccgtcgag tgggttcgaa cggatggtca
     7321 gccactgtcg ccgcgtcaca aggtccaggc acccggctat gttgtgatcg atgacattgt
     7381 gctcgatgat agcggtacct acgagtgccg ggcgagcaac atagctggcc aggtgagcgg
     7441 cttggccacc attaacgtcc aggagccaac tcttgtgcgg atcgaaccag ataggcaaca
     7501 ccatatcgtc acccagggcg acgaactctc gctcagctgc gtgggcagtg gcgtccctac
     7561 tccttcggtc ttttggagtt tcgagggaag agacgttgac aggatgggag taccggaagg
     7621 tgctgttttt gcgcaacctt tccgaaccaa cactgccgac gtgaaaatct tccgggtgag
     7681 caaggagaac gaaggcatct acgtctgtca cggatccaat gacgcgggtg aagatcaaca
     7741 atacattcgc gtggaggtac aacccagacg gggtgacgtc ggtgcaggag gagatgacaa
     7801 tggtgatgtc gatacccgac agccccccaa tcggccccaa atccaaccga atccattgag
     7861 caacgaacgc ctgaccaccg aattgggcaa caatgtgacc ctcatctgca acgtggacaa
     7921 cgtgaacacg gaatgggaac gcgtcgatgg cacacccctg ccgcacaatg cctacacggt
     7981 gagaaatacg ctggtgattg tcttcgtgga gccgcagaat ctgggtcagt accgctgcaa
     8041 tggaatcggt cgcgatggac gtgtggaggc ccatgtggtg agggagctgg ttctcctgcc
     8101 cctgcccagg atcaccttct atcccaacat cccgctgacc gtggagctgg gccagaactt
     8161 ggatgtctac tgccaggtgg agaacgtgcg tccggaggac gtgcattgga ccaccgacaa
     8221 caatcgacca ctgcccagtt ccgtacgcat cgagggcaat gtcctcaggt tcgcgtccat
     8281 cactcaggct gctgccggtg aataccgctg ctcggccacc aatcaatatg gaagccgatc
     8341 gaagaacgcc agggtggtgg tgaaacagcc cagtggcttc cagcccgttc cccactcgca
     8401 ggtgcaacag cgtcaggtgg gcgactccat ccagttgcga tgccgcctga ccacccagta
     8461 cggcgacgag gttcgcggca atatccagtt caactggtac cgtgaggacg gcagcccctt
     8521 gccccgcggt gtccgtccgg atagccaggt gctgcagctg gttaaattgc agcccgagga
     8581 cgagggccgc tacatctgca actcgtacga tttgggcagc gggcagcaac tgccccccgt
     8641 ctccatcgac ttgcaagtac taacggtacc agcggctccc cagaacccca tctacctgcc
     8701 gccagtggcg ccaccacgtt cgcccgaaag gatcctcgag ccccaactga gcctgagtgt
     8761 acaatcctcg aacctgccag ccggcgacgg caccaccgtc gagtgcttct cctccgatga
     8821 ctcctaccca gatgtcgtgt gggaacgcgc cgatggagct ccactcagcg aaaatgtcca
     8881 gcaagtgggc aataacctgg tgattagtaa cgtggcctcc accgatgccg gtaactatgt
     8941 gtgcaagtgc aagacggacg agggagatct gtataccacc agctacaaac tggaggtcga
     9001 ggagcagccc catgaactga agagctccaa gatagtctac gccaaggttg gcggaaatgc
     9061 cgacttgcag tgcggagccg atgaagatcg acagcccagc taccgttggt ctcgccaata
     9121 cggacaactt caggcgggac gcagtctgca gaatgagaaa ctttcgttgg atcgcgttca
     9181 ggccaacgat gccggaactt atgtttgttc ggcccaatac agcgatggcg agacggttga
     9241 cttccccaac attctggttg tgaccggggc gattccccag ttccgccagg agccccgcag
     9301 ctacatgagc ttccccacgc tctcgaactc ctcgttcaag ttcaacttcg agctgacctt
     9361 ccggccggaa aacgccgacg gactgctgct cttcaatgga cagacccgcg gaagcggtga
     9421 ctatatcgca ctctcgctga aggatcgcta tgcggagttc cggttcgatt ttggcggtaa
     9481 accgttgctg gtgcgagcgg aggagccact ggctttggat gaatggcaca cggtgcgcgt
     9541 gagtcgcttc aagcgggatg gctacatcca ggtggacgac cagcatccgg tggccttccc
     9601 cacctcccag catcagcaga taccccagtt ggaactgatt gaggatctgt acattggcgg
     9661 cgtgcccaac tgggagttcc tgcccgccga ggcggtgggt cagcaatcag gcttcgtggg
     9721 ctgcattagc cggctgaccc tgcagggacg caccgtggag ctgatccggg aggccaagtt
     9781 caaggagggc atcaccgatt gccggccctg cgcccaggga ccctgccaga acaagggcgt
     9841 ctgcctggag agccagacgg agcaggccta cacctgcgtc tgccagccgg gctggactgg
     9901 ccgggattgt gccatcgagg gcacccagtg caccgcagga gtttgcggct cgggacgctg
     9961 cgagaatacg gagaacgaca tggagtgcct gtgcccgctg aacagggcag gcgatcgatg
    10021 ccagtacaat gagattctaa atgaacagag cttgaatttc aagagcaaca gctttgcggc
    10081 ctacggaact cccaaggtca ccaaagtaaa catcacactc tccgttcgtc ccgcgagcct
    10141 ggaggactct gtgatcctgt acacggcgga atccactctg cccagcggcg attacctggc
    10201 tttggtcctt cgcggtggcc acgcggagct gctgatcaac acggccgccc gcttggatcc
    10261 cgtggtggtg cgttcggcgg aaccgctgcc cctcaatcgc tggaccagaa tcgagatcag
    10321 gcgtcgcctg ggcgagggaa tcctcaaggt gggcgatgga cccgagcgaa aggccaaggc
    10381 accgggatcc gatcgcattc tgtcgctcaa gacccacctc tttgtgggcg gcgtcgatcg
    10441 gtcgaccgta aagatcaacc gtgatgtgaa catcaccaag ggcttcgatg gctgcatctc
    10501 gaagctgtac aactcgcaga aatccgtcaa tctgctgggt gacatcaggg atgcggcgaa
    10561 tgtccagaac tgtggggagg cgaatgagat agatgacgat gagtatgaga tgccagtagc
    10621 gctgccatcg cctaaggtcg ccgagaatga acgtcagctg atggcgccgt gtgccagtga
    10681 tccctgcgag aacgggggaa gctgcagcga gcaggaggac atggccatct gctcctgtcc
    10741 cttcggcttc agcggcaaac actgccagaa tcacctccag ctgagcttca atgcctcgtt
    10801 ccgcggcgat ggctacgtgg agctgaaccg cagccacttc caacccgccc tggagcagac
    10861 gtactcccac attggcattg tgttcaccac caacaagccg aatggcctgc ttttctggtg
    10921 gggccaggag gccggggagg agtacaccgg acaggacttc attgccgccg ccgtggtcga
    10981 tggctatgtg gagtactcga tgaggctcga tggcgaggag gcggtcattc ggaacagcga
    11041 tatccgcgtg gacaatggcg agcggcacat tgtgatcgcc aagcgggatg agaacaccgc
    11101 catgctggaa ctcgatcaga tcctggacac gggcgatacg cgacccacca tcaacaaggc
    11161 aatgaagctg ccgggcaatg tgtttgtcgg tggcgctcct gatgtcgcgg cattcacggg
    11221 cttccgctac aaggacaatt tcaacggctg cattgtggtc gtcgagggcg aaaccgtggg
    11281 ccaaattaac cttagttcag ctgccatcaa tggagtgaat gccaacgtgt gtcccgctaa
    11341 cgacgaacct ctgggaggaa ccgaaccgcc agtcgtctga ggacacaacc agcaaccgaa
    11401 attagctttt taattaaaca ttaacaaatg aaacaaaaag aaaaacaatt tttatatata
    11461 caacatatga ataagcccca agcaaaccta caaaaaattg aatattatac gacgaacaga
    11521 taatataaaa acaaaaaaag agagaaacga tcacttctac tacaattgct tcttcgatcc
    11581 ttaagtctag gttaaagatt gtagcaagaa aacaagcgaa tatcacaaac atttatttaa
    11641 caagaacgcc atgcgagaag tgaaacgaaa cagaaacaat aatgcaatta atgcagataa
    11701 tacagataaa gcctagaacc ctaagaacta actaactaac tcgaacaaga acaacaacgc
    11761 atactagcca actgcaacca caacaaccac aatagtgaag gcattttaat tataatttta
    11821 gtctctagct tataactatg actacgactc gttttttttg tgagcccagt gtaaaatgtt
    11881 ggaaatcgga aattggccct acacacaaac acacacaagt tattaattaa ataccaattg
    11941 ataccatata atgataaatg aaatactatg aatgcaacta ttgtgaacga acgaaaaccg
    12001 ttgagtggat aaaaagcata agcagaagat atattaaaat gaaatcaaca aca