Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_044396088           12545 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X37, mRNA.
ACCESSION   XM_044396088
VERSION     XM_044396088.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..12545
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..12545
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..11872
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X36"
                     /protein_id="XP_044252023.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSEFDEDPIEVALP
                     TDEVEGSGQDSGSCRGDATFQCRRSGKTICDEMRCDGSRDCPDAEDEEGCEVCNELQF
                     KCDNKCLPLNKRCDNRYDCEDQTDEAGCQRYEVEESQPQPQPQPQPEPEPEPEPEPEP
                     EPEPEPEPEEPITDNEQPEQNSECRATEFRCNNGDCIDIRKRCDHISDCSEGEDENEE
                     CRSSPQSSCLENIEFACHNRDCIPIESVCDGTPDCGRSEDEDDALCKCTADKYKCQHG
                     GGCIPKTQVCDGKPQCRDRSDESACPTTRLKPSDCGPDQFFCDDLCYNRSIRCNGHMD
                     CSDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCEDGSDEANCCYADQFRC
                     NNGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKNGQCVSSTARCNKRSDC
                     LDGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIFRCRDEGPNRAKVKWSR
                     PGGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIPGQHVTVNLNVERLNER
                     EIRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSCSLGLKCQPNQFMCSNS
                     KCVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGHCIPKSFQCDYMNDC
                     TDGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTPTIVWRLNWGHVPEKCE
                     SKSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVRSDVCKAGFFN
                     MLARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVSVELSPFRQIVINEASP
                     GQDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSYGGNLRYEVRYNGNGRP
                     VSGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPDGRKGTREDIMMILANV
                     DNILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEKCTCPPGYVGDSCESCA
                     SGYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPCPHAGANNFASGCQQSP
                     DGDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQ
                     CKDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSSWYRNQVTSTFGRTR
                     VNHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNTLYWSLPAAFLGNKLTS
                     YGGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPSVANTYAVEIK
                     ESAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASLRSVTLDTATATNLGTA
                     RAVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPCECNGHSKYCNSETGEC
                     ESCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSRPPAPGNQTAECLVNCQ
                     QEGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCKECYCSGLTNQCRSASL
                     YRQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKHTSYTPKYWSLRGSVLG
                     NQLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRPDGHDNEQEYHVRLHED
                     EQWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVSTSISNVILESSITTRAP
                     GATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPCDASNTESCGLVSGGNV
                     ECQCRPRWRGDRCREIETNEPTPEPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLS
                     CTGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGH
                     SFTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGH
                     ADAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDR
                     LYITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRD
                     ANVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGE
                     DLSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTIYGGRSENRGLYSCIAENSHG
                     SDQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLS
                     PRHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGLATINVQEPTLVRIEPDRQHH
                     IVTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRV
                     SKENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPN
                     PLSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLG
                     QYRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLTVELGQNLDVYCQVENVRPED
                     VHWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCSATNQYGSRSKNARVVVKQPS
                     GFQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQ
                     VLQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVLTVPAAPQNPIYLPPVAPPRS
                     PERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNN
                     LVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQ
                     CGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDF
                     PNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSG
                     DYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPV
                     AFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELI
                     REAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAG
                     VCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNI
                     TLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPL
                     PLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINR
                     DVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPK
                     VAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGD
                     GYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDG
                     YVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINK
                     AMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVC
                     PANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1268..1360
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1268..1270,1295..1297,1328..1333)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1307..1309,1316..1318,1328..1330,1346..1351)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1337..1351
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1367..1468
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1382..1384,1403..1405,1436..1441)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1415..1417,1424..1426,1436..1438,1454..1459)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1445..1459
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1625..1723
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1643..1645,1667..1669,1700..1705)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1679..1681,1688..1690,1700..1702,1718..1723)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1709..1723
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1757..1861
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1775..1777,1799..1801,1832..1837)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1811..1813,1820..1822,1832..1834,1850..1855)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1841..1855
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1874..1981
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1889..1891,1916..1918,1949..1954)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1928..1930,1937..1939,1949..1951,1967..1972)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1958..1972
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2009..2110
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2024..2026,2045..2047,2078..2083)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2057..2059,2066..2068,2078..2080,2096..2101)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2087..2101
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2138..2230
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2141..2143,2165..2167,2198..2203)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2177..2179,2186..2188,2198..2200,2216..2221)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2207..2221
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2231..2335
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2246..2248,2270..2272,2303..2308)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2282..2284,2291..2293,2303..2305,2321..2326)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2312..2326
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2351..2455
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2366..2368,2390..2392,2423..2428)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2402..2404,2411..2413,2423..2425,2441..2446)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2432..2446
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2498..2704
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    2798..2902
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2813..2815,2837..2839,2870..2875)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2849..2851,2858..2860,2870..2872,2888..2893)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2879..2893
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2918..3022
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2933..2935,2957..2959,2990..2995)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2969..2971,2978..2980,2990..2992,3008..3013)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2999..3013
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3047..3151
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3062..3064,3086..3088,3119..3124)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3098..3100,3107..3109,3119..3121,3137..3142)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3128..3142
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3203..3430
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    3212..3226
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:143220"
     misc_feature    3251..3265
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:143220"
     misc_feature    3320..3334
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:143220"
     misc_feature    3362..3379
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:143220"
     misc_feature    3404..3415
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:143220"
     misc_feature    3725..4117
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4286..4447
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(4286..4288,4292..4294,4328..4330,4358..4360,
                     4364..4366,4391..4393)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    4466..4579
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    4820..5230
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <5231..5311
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    5333..5482
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(5336..5338,5342..5344,5363..5365,5384..5386,
                     5393..5395,5420..5422)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <5591..5683
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    5879..6283
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6560..6808
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6593..6607
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6641..6655
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6698..6712
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    6740..6757
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6785..6796
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <6887..7048
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    7139..7390
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7172..7186
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    7211..7225
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    7280..7294
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    7322..7339
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    7427..7669
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7478..7492
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    7517..7531
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    7574..7588
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    7616..7633
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    7655..7666
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    7721..7951
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    7745..7759
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    7784..7798
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    7847..7861
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    7889..7906
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    7928..7939
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409544"
     misc_feature    7988..8251
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8018..8032
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409548"
     misc_feature    8057..8071
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409548"
     misc_feature    8189..8206
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409548"
     misc_feature    8624..8854
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8651..8665
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409541"
     misc_feature    8690..8704
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409541"
     misc_feature    8750..8764
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409541"
     misc_feature    8792..8809
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409541"
     misc_feature    8888..>9091
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8921..8935
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    8969..8992
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9038..9052
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9233..9439
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9527..9727
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9551..9565
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9590..9604
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9647..9661
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9689..9706
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409390"
     misc_feature    9791..10234
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    10301..10399
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    10541..11002
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11162..11260
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    11285..11746
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      12545
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgaattc gatgaggatc ctatcgaagt
     1201 tgcattgccc acggatgagg tggagggctc cggccaagat tccggtagct gtcgcggcga
     1261 tgccaccttc cagtgtcgaa ggagtggaaa gactatttgc gatgaaatgc gatgcgatgg
     1321 atctcgcgat tgtcccgatg ccgaggacga ggaaggctgc gaggtttgca acgaacttca
     1381 gttcaagtgc gataacaagt gtctgccgct caataagcgc tgcgataatc gatacgattg
     1441 tgaggatcag acggacgagg ctggttgtca acggtacgaa gtagaagagt ctcagcctca
     1501 gccgcagccg caacctcagc ctgaaccgga acctgaacct gaacctgagc ctgagcctga
     1561 acctgaacca gaaccagaac ctgaagagcc tataacagac aatgaacagc ctgagcaaaa
     1621 ctcagaatgc cgggccaccg agttcagatg caacaatggg gactgcatcg atattagaaa
     1681 gcgttgcgat cacatttcgg actgtagcga aggcgaggac gagaacgagg agtgccgcag
     1741 ctcacctcag tcctcctgtc tcgaaaacat cgaattcgcg tgtcacaatc gcgattgcat
     1801 tccgattgag agcgtctgcg atggcacccc cgactgcgga cgcagtgaag acgaggacga
     1861 cgctctttgc aagtgcaccg ccgacaagta caaatgccaa cacggcggag gctgcattcc
     1921 gaaaacccag gtgtgcgatg gcaaacctca gtgccgcgac cgcagcgacg agagcgcctg
     1981 ccccaccaca cgactaaagc ccagcgactg cggtccggat cagttcttct gcgatgattt
     2041 atgctataat cgctctattc gatgcaatgg ccatatggat tgctcagatg gcagtgatga
     2101 gatcgcttgt agctcgctgt cagtgcttcc atgtccacag caccagtgtc ccagtggcag
     2161 gtgttattcg gaaagtgagc gatgcgatcg ccacaggcac tgcgaggatg gctccgatga
     2221 ggccaactgc tgttacgcgg atcaattccg ctgcaataat ggtgactgca ttgcggaatc
     2281 ggctcattgc gatggaaata tcgattgtag cgaccagtcc gatgaactcg actgcggagg
     2341 agactcgcag tgtctgccca accaattccg ctgcaagaat ggccaatgtg tgagctctac
     2401 agcgcgttgc aacaagcgtt ccgattgttt ggatggctcc gatgagcaga attgtgccaa
     2461 tgaacctaac aactccggac gtggaacgaa ccaattgaaa ctcaagacct atcccgacaa
     2521 ccaaatcatt aaggagagtc gtgaggtcat cttccgttgc cgtgacgaag gtcccaaccg
     2581 cgccaaggtc aagtggtcgc gacccggcgg acgtcccctg ccccccggtt tcaccgatcg
     2641 caatggccgc ctggagatcc ccaacatcag ggtggaggat gctggcgcct atgtctgcga
     2701 ggccgtgggc tatgccaact atattcccgg tcagcacgtc accgtaaacc tcaacgtcga
     2761 gcgcttaaac gaacgcgaaa tccgtccgga ctcagcctgt acggagtacc aggccacctg
     2821 catgaacggc gagtgtatcg ataagtcggg catctgcgat ggacatccgg actgttcgga
     2881 tggctccgat gagcacagct gcagtttggg tttgaagtgt cagcccaacc agttcatgtg
     2941 ctccaattcc aagtgtgtgg atcgcacctg gcgctgtgat ggcgagaacg actgcggcga
     3001 taactccgat gagacctctt gcgatccgga accaagtgat gctccgtgcc gatacgacga
     3061 attccagtgc cgcagcggtc attgcattcc caagagcttc cagtgcgact atatgaacga
     3121 ttgtaccgat ggtaccgatg aaattggatg ctcggtgccc tctccaatga ccctacccgc
     3181 accctcgatt gtcgtgatgg agtacgaggt cctcgagctg acctgcgtgg gcaccggcgt
     3241 cccgacgccg acgatcgtgt ggcgtctcaa ctggggccat gtgcccgaga agtgtgaatc
     3301 gaagagctac ggcggaaccg gaaccctgcg ctgtccgaac atgaggcccc aggacagtgg
     3361 tgcctactcg tgcgagttca tcaacacacg cggcaccttc tatccgaaaa cgaactcgat
     3421 tgtcaccgtt acgccggtgc gctcggatgt ctgcaaggcc ggattcttca atatgctggc
     3481 ccgcaagtcg gaggaatgcg tccagtgctt ctgctttggc gtttcgacca actgtgacag
     3541 tgccaatttg ttcacctacg ccattcagcc accgatcctt tcgcaccgcg tggtcagcgt
     3601 tgaactcagt ccgttccgtc aaattgtcat caatgaggct agtccgggtc aggatctgct
     3661 caccttgcac catggtgttc agttcagggc atcgaacgta cactacaacg gccgggagac
     3721 accattcttg gccctgcccg ctgagtatat gggcaaccag ctgaagtcct atggcggcaa
     3781 tctgcgctac gaggtcaggt acaatggcaa cggtagaccg gtcagcggac ccgatgtcat
     3841 catcaccggc aacagtttca cgctaaccca tcgcgttcgc actcatccgg gtcagaacaa
     3901 cagggtgact attcccttcc tgccgggagg ctggacgaag ccggatggtc gcaagggaac
     3961 gcgagaggac atcatgatga tactggccaa tgtggacaat attctgattc gactgggcta
     4021 cctggatagc acagctcgcg aagtggatct gataaatatc gccttggatt cggccggaag
     4081 tgccgatcag ggattgggca gtgcctcgct cgtggagaag tgcacctgtc cgcccggcta
     4141 tgttggtgat tcgtgcgagt cctgtgcctc gggctatgtt cgccaggccc gcggaccttg
     4201 gctgggtcat tgtgtgccct tcaccccgga accgtgccca gcgggaacct acggcaatcc
     4261 ccgacttggt gttccctgcc aggagtgtcc gtgcccccac gcgggcgcca ataactttgc
     4321 cagcggctgc caacagagtc ccgatggcga tgtgatttgc cgctgcaacg aaggctatgc
     4381 cggcaagagg tgcgagcact gcgcccaggg ttaccagggt aatccgttgg caccgggagg
     4441 agtctgtcgc aagatacccg atagttcgtg caatgtcgac ggcacctaca acatctacag
     4501 caatggaacg tgccagtgca aggatagcgt gattggcgaa cagtgcgaca cctgcgcgcc
     4561 gaagagtttc cacctcaatt cgttcaccta caccggttgc atcgagtgct tctgcagtgg
     4621 agtgggcttg gattgtgaca gtagttcgtg gtatcgcaac caggtcacca gcacctttgg
     4681 acgaacgcgc gtcaatcatg gattcgccct gattagcgac tatatgcgca ataccccggt
     4741 aacggtgccc gtttccatgt ccacccaggc caatgccttg agcttcgtgg gatccgccga
     4801 gcaggccggt aatacgctct actggagtct tcccgccgcc ttcctgggca acaagctgac
     4861 ctcgtacgga ggcaagttga gctacacgct cagctacagt cccctgccca gcggcattat
     4921 gtcgcgcaac agtgcccccg atgtggtgat caagagcggc gaggatctga ggctcatcca
     4981 ttacaggaag tcgcaggtca gtcccagtgt ggccaacacc tatgccgtgg agatcaagga
     5041 gagcgcatgg cagcgcggcg atgaactggt gcctaaccgt gaacacgtcc tgatggccct
     5101 cagcaatatt acggccatct atatcaaggc cacgtacacg actagcacca aggaggcctc
     5161 gctgcgatcg gtcacattgg atacggccac ggccaccaat ctgggcaccg cacgtgccgt
     5221 cgaagtggag cagtgccgct gtcccgaggg ctatttgggt ctctcctgcg agcagtgtgc
     5281 tcctggctat acgcgcgatc cggaggcagg aatctatctg ggtctctgca ggccctgcga
     5341 gtgcaatgga cattccaagt attgcaacag tgagacaggc gaatgcgaaa gctgttccga
     5401 caacaccgaa ggattcaatt gtgaccgatg cgccgccggc tatgtgggtg atgccacccg
     5461 aggaacttcg tacgactgtc aatacgatga cggcggctat ccgacgtcgc gtccaccggc
     5521 accgggcaat cagacggccg aatgcctggt gaattgccaa caggagggaa ccgccggttg
     5581 ccgcggctac cagtgcgagt gcaagaggaa tgtggctggc gatcgatgcg atcagtgccg
     5641 ccccggaacc tatggactgt cggcccaaaa tccggacggt tgcaaggagt gctactgctc
     5701 cggactgacc aaccagtgcc gctcggcgtc tctctaccgc cagctgatac ccgtggactt
     5761 catttcgacg ccaccattga taacagacga attcggcgac atcatggata gggataacct
     5821 tgtgcccgac gtgcccagga atgtgtatac ctacaagcac acctcctaca cgcccaagta
     5881 ctggagcctg aggggtagtg tgctgggcaa ccagctgttg tcgtacggcg gccgcttgga
     5941 gtacagcctg attgtggagt ccgttggccg ggaccatcgt ggcaaggatg tggtcctaat
     6001 tggcaacgga ctcaagctga tctggtcgcg acccgatggc catgacaacg agcaggaata
     6061 ccatgtgcgt ttgcatgagg acgagcagtg gacggttgag gatcgtggat cggcacgaca
     6121 ggccacgcgg gccgacttca tgactgtgct gtcggatctg cagcacatcc tgatcctggc
     6181 cacacccaag gtgcccacgg tcagcacctc gattagcaat gtcatcctgg agagttcgat
     6241 aaccacgaga gcgcctggag ctacgcatgc ctccgatatc gagttgtgcc agtgtccatc
     6301 cggttatacg ggcacttcct gtgagtcctg cgcaccactg cactaccgcg acgcctctgg
     6361 acgctgcagt cagtgtcctt gcgacgcttc caacacggaa tcctgcggct tggtcagcgg
     6421 cggtaacgtc gaatgccagt gcaggccacg ctggaggggt gatcgctgcc gggaaattga
     6481 aactaacgaa ccgactccgg aaccggatac cagtaccgat gatcccgtgc gcacccagat
     6541 catagtgtcg attgccaggc cagagattac cattctgccc gtgggtggat cgctgaccct
     6601 cagctgtacc ggtcgaatgc gctggaccaa tagcccagtg tttgtgaact ggtacaagca
     6661 gggcagtcac ctgcccgagg gagtcgaggt gcaaggcggt aatctgcagc tgttcaacct
     6721 gcagatcagc gattctggaa tctacatctg ccaggccgta agcaacgaga ccggccacag
     6781 ctttacggac cacgtctcca tcaccgtttc ccaggaggac caacgctcgc cggctcacat
     6841 tgtggatttg cccaacgacg tgaccttcga ggagtacgta agcaatgaga tcgtctgcga
     6901 ggtggagggc aacccaccac ccactgtcac ctggactcgc gtggatggcc atgcggacgc
     6961 ccaaagtacg cgaacggaca acaatcggct ggtcttcgat tcgccgagga aatcggacga
     7021 gggtcgctat cgctgccagg cagagaatag cctgagtcgg gaggagaagt acgtagtcgt
     7081 gtatgtccgg agcaatcctc cccagccgcc gccgcagcag gatcgtttgt acatcacacc
     7141 gcaggaggtg aacggtgtgg ccggtgactc cttccagttg tcctgccaat tcaccagcgc
     7201 tgcctctctg cgctacgatt ggtcccacga tggtcgctcc ctgtccgcgt cgtcaccccg
     7261 aaatgttgtg gtccgcggaa atgtcctgga agtccgcgat gccaacgttc gcgactccgg
     7321 cacctacacc tgtgtggcct tcgacctgcg cacccgacgc aacttcaccg agagcgcacg
     7381 ggtctacatc gagcagccca acgagccggg aatccttggc gacaagccgc atatcttgac
     7441 cttggagcag aacatcataa ttgtgcaagg cgaggacttg agcatcacat gtgaggcaag
     7501 tggaacgccc tatccctcga ttaagtggac caaggtgcag gagaatctgg ccgaaaatgt
     7561 ccgcatcagt ggcaatgtgc tcaccatcta cggaggccgc agtgagaatc gtggtcttta
     7621 ctcctgcatc gccgagaact ctcacggcag cgatcagtcc agcacaagca tcgatattga
     7681 accccgggag cggccgagtc ttacgattga tacggccacc caaaaggttt cggttggctc
     7741 ccaggcgtcc ctttactgtg ccgcccaggg cattcccgaa ccgaccgtcg agtgggttcg
     7801 aacggatggt cagccactgt cgccgcgtca caaggtccag gcacccggct atgttgtgat
     7861 cgatgacatt gtgctcgatg atagcggtac ctacgagtgc cgggcgagca acatagctgg
     7921 ccaggtgagc ggcttggcca ccattaacgt ccaggagcca actcttgtgc ggatcgaacc
     7981 agataggcaa caccatatcg tcacccaggg cgacgaactc tcgctcagct gcgtgggcag
     8041 tggcgtccct actccttcgg tcttttggag tttcgaggga agagacgttg acaggatggg
     8101 agtaccggaa ggtgctgttt ttgcgcaacc tttccgaacc aacactgccg acgtgaaaat
     8161 cttccgggtg agcaaggaga acgaaggcat ctacgtctgt cacggatcca atgacgcggg
     8221 tgaagatcaa caatacattc gcgtggaggt acaacccaga cggggtgacg tcggtgcagg
     8281 aggagatgac aatggtgatg tcgatacccg acagcccccc aatcggcccc aaatccaacc
     8341 gaatccattg agcaacgaac gcctgaccac cgaattgggc aacaatgtga ccctcatctg
     8401 caacgtggac aacgtgaaca cggaatggga acgcgtcgat ggcacacccc tgccgcacaa
     8461 tgcctacacg gtgagaaata cgctggtgat tgtcttcgtg gagccgcaga atctgggtca
     8521 gtaccgctgc aatggaatcg gtcgcgatgg acgtgtggag gcccatgtgg tgagggagct
     8581 ggttctcctg cccctgccca ggatcacctt ctatcccaac atcccgctga ccgtggagct
     8641 gggccagaac ttggatgtct actgccaggt ggagaacgtg cgtccggagg acgtgcattg
     8701 gaccaccgac aacaatcgac cactgcccag ttccgtacgc atcgagggca atgtcctcag
     8761 gttcgcgtcc atcactcagg ctgctgccgg tgaataccgc tgctcggcca ccaatcaata
     8821 tggaagccga tcgaagaacg ccagggtggt ggtgaaacag cccagtggct tccagcccgt
     8881 tccccactcg caggtgcaac agcgtcaggt gggcgactcc atccagttgc gatgccgcct
     8941 gaccacccag tacggcgacg aggttcgcgg caatatccag ttcaactggt accgtgagga
     9001 cggcagcccc ttgccccgcg gtgtccgtcc ggatagccag gtgctgcagc tggttaaatt
     9061 gcagcccgag gacgagggcc gctacatctg caactcgtac gatttgggca gcgggcagca
     9121 actgcccccc gtctccatcg acttgcaagt actaacggta ccagcggctc cccagaaccc
     9181 catctacctg ccgccagtgg cgccaccacg ttcgcccgaa aggatcctcg agccccaact
     9241 gagcctgagt gtacaatcct cgaacctgcc agccggcgac ggcaccaccg tcgagtgctt
     9301 ctcctccgat gactcctacc cagatgtcgt gtgggaacgc gccgatggag ctccactcag
     9361 cgaaaatgtc cagcaagtgg gcaataacct ggtgattagt aacgtggcct ccaccgatgc
     9421 cggtaactat gtgtgcaagt gcaagacgga cgagggagat ctgtatacca ccagctacaa
     9481 actggaggtc gaggagcagc cccatgaact gaagagctcc aagatagtct acgccaaggt
     9541 tggcggaaat gccgacttgc agtgcggagc cgatgaagat cgacagccca gctaccgttg
     9601 gtctcgccaa tacggacaac ttcaggcggg acgcagtctg cagaatgaga aactttcgtt
     9661 ggatcgcgtt caggccaacg atgccggaac ttatgtttgt tcggcccaat acagcgatgg
     9721 cgagacggtt gacttcccca acattctggt tgtgaccggg gcgattcccc agttccgcca
     9781 ggagccccgc agctacatga gcttccccac gctctcgaac tcctcgttca agttcaactt
     9841 cgagctgacc ttccggccgg aaaacgccga cggactgctg ctcttcaatg gacagacccg
     9901 cggaagcggt gactatatcg cactctcgct gaaggatcgc tatgcggagt tccggttcga
     9961 ttttggcggt aaaccgttgc tggtgcgagc ggaggagcca ctggctttgg atgaatggca
    10021 cacggtgcgc gtgagtcgct tcaagcggga tggctacatc caggtggacg accagcatcc
    10081 ggtggccttc cccacctccc agcatcagca gataccccag ttggaactga ttgaggatct
    10141 gtacattggc ggcgtgccca actgggagtt cctgcccgcc gaggcggtgg gtcagcaatc
    10201 aggcttcgtg ggctgcatta gccggctgac cctgcaggga cgcaccgtgg agctgatccg
    10261 ggaggccaag ttcaaggagg gcatcaccga ttgccggccc tgcgcccagg gaccctgcca
    10321 gaacaagggc gtctgcctgg agagccagac ggagcaggcc tacacctgcg tctgccagcc
    10381 gggctggact ggccgggatt gtgccatcga gggcacccag tgcaccgcag gagtttgcgg
    10441 ctcgggacgc tgcgagaata cggagaacga catggagtgc ctgtgcccgc tgaacagggc
    10501 aggcgatcga tgccagtaca atgagattct aaatgaacag agcttgaatt tcaagagcaa
    10561 cagctttgcg gcctacggaa ctcccaaggt caccaaagta aacatcacac tctccgttcg
    10621 tcccgcgagc ctggaggact ctgtgatcct gtacacggcg gaatccactc tgcccagcgg
    10681 cgattacctg gctttggtcc ttcgcggtgg ccacgcggag ctgctgatca acacggccgc
    10741 ccgcttggat cccgtggtgg tgcgttcggc ggaaccgctg cccctcaatc gctggaccag
    10801 aatcgagatc aggcgtcgcc tgggcgaggg aatcctcaag gtgggcgatg gacccgagcg
    10861 aaaggccaag gcaccgggat ccgatcgcat tctgtcgctc aagacccacc tctttgtggg
    10921 cggcgtcgat cggtcgaccg taaagatcaa ccgtgatgtg aacatcacca agggcttcga
    10981 tggctgcatc tcgaagctgt acaactcgca gaaatccgtc aatctgctgg gtgacatcag
    11041 ggatgcggcg aatgtccaga actgtgggga ggcgaatgag atagatgacg atgagtatga
    11101 gatgccagta gcgctgccat cgcctaaggt cgccgagaat gaacgtcagc tgatggcgcc
    11161 gtgtgccagt gatccctgcg agaacggggg aagctgcagc gagcaggagg acatggccat
    11221 ctgctcctgt cccttcggct tcagcggcaa acactgccag aatcacctcc agctgagctt
    11281 caatgcctcg ttccgcggcg atggctacgt ggagctgaac cgcagccact tccaacccgc
    11341 cctggagcag acgtactccc acattggcat tgtgttcacc accaacaagc cgaatggcct
    11401 gcttttctgg tggggccagg aggccgggga ggagtacacc ggacaggact tcattgccgc
    11461 cgccgtggtc gatggctatg tggagtactc gatgaggctc gatggcgagg aggcggtcat
    11521 tcggaacagc gatatccgcg tggacaatgg cgagcggcac attgtgatcg ccaagcggga
    11581 tgagaacacc gccatgctgg aactcgatca gatcctggac acgggcgata cgcgacccac
    11641 catcaacaag gcaatgaagc tgccgggcaa tgtgtttgtc ggtggcgctc ctgatgtcgc
    11701 ggcattcacg ggcttccgct acaaggacaa tttcaacggc tgcattgtgg tcgtcgaggg
    11761 cgaaaccgtg ggccaaatta accttagttc agctgccatc aatggagtga atgccaacgt
    11821 gtgtcccgct aacgacgaac ctctgggagg aaccgaaccg ccagtcgtct gaggacacaa
    11881 ccagcaaccg aaattagctt tttaattaaa cattaacaaa tgaaacaaaa agaaaaacaa
    11941 tttttatata tacaacatat gaataagccc caagcaaacc tacaaaaaat tgaatattat
    12001 acgacgaaca gataatataa aaacaaaaaa agagagaaac gatcacttct actacaattg
    12061 cttcttcgat ccttaagtct aggttaaaga ttgtagcaag aaaacaagcg aatatcacaa
    12121 acatttattt aacaagaacg ccatgcgaga agtgaaacga aacagaaaca ataatgcaat
    12181 taatgcagat aatacagata aagcctagaa ccctaagaac taactaacta actcgaacaa
    12241 gaacaacaac gcatactagc caactgcaac cacaacaacc acaatagtga aggcatttta
    12301 attataattt tagtctctag cttataacta tgactacgac tcgttttttt tgtgagccca
    12361 gtgtaaaatg ttggaaatcg gaaattggcc ctacacacaa acacacacaa gttattaatt
    12421 aaataccaat tgataccata taatgataaa tgaaatacta tgaatgcaac tattgtgaac
    12481 gaacgaaaac cgttgagtgg ataaaaagca taagcagaag atatattaaa atgaaatcaa
    12541 caaca