Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_044396087           12890 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X35, mRNA.
ACCESSION   XM_044396087
VERSION     XM_044396087.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..12890
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..12890
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..12217
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X34"
                     /protein_id="XP_044252022.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECPEEEEDSVGIPIGRPPQRPAPKHDWL
                     DELDANEYHVYHPSNVYELANSKNPCASNQFRCATTNVCIPLHLRCDNFYHCNDMSDE
                     KDCEQYQRRTTTTTRRPSTSARPSFTFTFTTQGPGLLERRNSTTSRTTAGSTTRATEA
                     PQWPWATRPTETTTTNPITTVGVATTTRLKPSDCGPDQFFCDDLCYNRSIRCNGHMDC
                     SDGSDEIACSSLSVLPCPQHQCPSGRCYSESERCDRHRHCEDGSDEANCCYADQFRCN
                     NGDCIAESAHCDGNIDCSDQSDELDCGGDSQCLPNQFRCKNGQCVSSTARCNKRSDCL
                     DGSDEQNCANEPNNSGRGTNQLKLKTYPDNQIIKESREVIFRCRDEGPNRAKVKWSRP
                     GGRPLPPGFTDRNGRLEIPNIRVEDAGAYVCEAVGYANYIPGQHVTVNLNVERLNERE
                     IRPDSACTEYQATCMNGECIDKSGICDGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSK
                     CVDRTWRCDGENDCGDNSDETSCDPEPSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCT
                     DGTDEIGCSVPSPMTLPAPSIVVMEYEVLELTCVGTGVPTPTIVWRLNWGHVPEKCES
                     KSYGGTGTLRCPNMRPQDSGAYSCEFINTRGTFYPKTNSIVTVTPVRSDVCKAGFFNM
                     LARKSEECVQCFCFGVSTNCDSANLFTYAIQPPILSHRVVSVELSPFRQIVINEASPG
                     QDLLTLHHGVQFRASNVHYNGRETPFLALPAEYMGNQLKSYGGNLRYEVRYNGNGRPV
                     SGPDVIITGNSFTLTHRVRTHPGQNNRVTIPFLPGGWTKPDGRKGTREDIMMILANVD
                     NILIRLGYLDSTAREVDLINIALDSAGSADQGLGSASLVEKCTCPPGYVGDSCESCAS
                     GYVRQARGPWLGHCVPFTPEPCPAGTYGNPRLGVPCQECPCPHAGANNFASGCQQSPD
                     GDVICRCNEGYAGKRCEHCAQGYQGNPLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQC
                     KDSVIGEQCDTCAPKSFHLNSFTYTGCIECFCSGVGLDCDSSSWYRNQVTSTFGRTRV
                     NHGFALISDYMRNTPVTVPVSMSTQANALSFVGSAEQAGNTLYWSLPAAFLGNKLTSY
                     GGKLSYTLSYSPLPSGIMSRNSAPDVVIKSGEDLRLIHYRKSQVSPSVANTYAVEIKE
                     SAWQRGDELVPNREHVLMALSNITAIYIKATYTTSTKEASLRSVTLDTATATNLGTAR
                     AVEVEQCRCPEGYLGLSCEQCAPGYTRDPEAGIYLGLCRPCECNGHSKYCNSETGECE
                     SCSDNTEGFNCDRCAAGYVGDATRGTSYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQ
                     EGTAGCRGYQCECKRNVAGDRCDQCRPGTYGLSAQNPDGCKECYCSGLTNQCRSASLY
                     RQLIPVDFISTPPLITDEFGDIMDRDNLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGN
                     QLLSYGGRLEYSLIVESVGRDHRGKDVVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDE
                     QWTVEDRGSARQATRADFMTVLSDLQHILILATPKVPTVSTSISNVILESSITTRAPG
                     ATHASDIELCQCPSGYTGTSCESCAPLHYRDASGRCSQCPCDASNTESCGLVSGGNVE
                     CQCRPRWRGDRCREIETNEPTPEPDTSTDDPVRTQIIVSIARPEITILPVGGSLTLSC
                     TGRMRWTNSPVFVNWYKQGSHLPEGVEVQGGNLQLFNLQISDSGIYICQAVSNETGHS
                     FTDHVSITVSQEDQRSPAHIVDLPNDVTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHA
                     DAQSTRTDNNRLVFDSPRKSDEGRYRCQAENSLSREEKYVVVYVRSNPPQPPPQQDRL
                     YITPQEVNGVAGDSFQLSCQFTSAASLRYDWSHDGRSLSASSPRNVVVRGNVLEVRDA
                     NVRDSGTYTCVAFDLRTRRNFTESARVYIEQPNEPGILGDKPHILTLEQNIIIVQGED
                     LSITCEASGTPYPSIKWTKVQENLAENVRISGNVLTIYGGRSENRGLYSCIAENSHGS
                     DQSSTSIDIEPRERPSLTIDTATQKVSVGSQASLYCAAQGIPEPTVEWVRTDGQPLSP
                     RHKVQAPGYVVIDDIVLDDSGTYECRASNIAGQVSGLATINVQEPTLVRIEPDRQHHI
                     VTQGDELSLSCVGSGVPTPSVFWSFEGRDVDRMGVPEGAVFAQPFRTNTADVKIFRVS
                     KENEGIYVCHGSNDAGEDQQYIRVEVQPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNP
                     LSNERLTTELGNNVTLICNVDNVNTEWERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQ
                     YRCNGIGRDGRVEAHVVRELVLLPLPRITFYPNIPLTVELGQNLDVYCQVENVRPEDV
                     HWTTDNNRPLPSSVRIEGNVLRFASITQAAAGEYRCSATNQYGSRSKNARVVVKQPSG
                     FQPVPHSQVQQRQVGDSIQLRCRLTTQYGDEVRGNIQFNWYREDGSPLPRGVRPDSQV
                     LQLVKLQPEDEGRYICNSYDLGSGQQLPPVSIDLQVLTVPAAPQNPIYLPPVAPPRSP
                     ERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVGNNL
                     VISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNADLQC
                     GADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETVDFP
                     NILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRGSGD
                     YIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQHPVA
                     FPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVELIR
                     EAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCTAGV
                     CGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKVNIT
                     LSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAEPLP
                     LNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKINRD
                     VNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPSPKV
                     AENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFRGDG
                     YVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVVDGY
                     VEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTINKA
                     MKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNANVCP
                     ANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1361..1453
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1361..1363,1388..1390,1421..1426)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1400..1402,1409..1411,1421..1423,1439..1444)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1430..1444
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1807
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    1982..2089
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1997..1999,2024..2026,2057..2062)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2036..2038,2045..2047,2057..2059,2075..2080)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2066..2080
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2354..2455
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2369..2371,2390..2392,2423..2428)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2402..2404,2411..2413,2423..2425,2441..2446)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2432..2446
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2483..2575
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2486..2488,2510..2512,2543..2548)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2522..2524,2531..2533,2543..2545,2561..2566)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2552..2566
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2576..2680
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2591..2593,2615..2617,2648..2653)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2627..2629,2636..2638,2648..2650,2666..2671)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2657..2671
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2696..2800
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2711..2713,2735..2737,2768..2773)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2747..2749,2756..2758,2768..2770,2786..2791)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2777..2791
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2843..3049
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    3143..3247
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3158..3160,3182..3184,3215..3220)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3194..3196,3203..3205,3215..3217,3233..3238)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3224..3238
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3263..3367
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3278..3280,3302..3304,3335..3340)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3314..3316,3323..3325,3335..3337,3353..3358)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3344..3358
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3392..3496
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3407..3409,3431..3433,3464..3469)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3443..3445,3452..3454,3464..3466,3482..3487)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3473..3487
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3548..3775
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    3557..3571
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:143220"
     misc_feature    3596..3610
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:143220"
     misc_feature    3665..3679
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:143220"
     misc_feature    3707..3724
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:143220"
     misc_feature    3749..3760
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:143220"
     misc_feature    4070..4462
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4631..4792
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(4631..4633,4637..4639,4673..4675,4703..4705,
                     4709..4711,4736..4738)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    4811..4924
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    5165..5575
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <5576..5656
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    5678..5827
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(5681..5683,5687..5689,5708..5710,5729..5731,
                     5738..5740,5765..5767)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <5936..6028
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    6224..6628
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6905..7153
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6938..6952
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6986..7000
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    7043..7057
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    7085..7102
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7130..7141
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <7232..7393
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    7484..7735
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7517..7531
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    7556..7570
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    7625..7639
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    7667..7684
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    7772..8014
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7823..7837
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    7862..7876
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    7919..7933
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    7961..7978
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    8000..8011
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    8066..8296
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    8090..8104
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    8129..8143
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    8192..8206
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    8234..8251
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    8273..8284
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409544"
     misc_feature    8333..8596
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8363..8377
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409548"
     misc_feature    8402..8416
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409548"
     misc_feature    8534..8551
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409548"
     misc_feature    8969..9199
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8996..9010
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409541"
     misc_feature    9035..9049
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409541"
     misc_feature    9095..9109
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409541"
     misc_feature    9137..9154
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409541"
     misc_feature    9233..>9436
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9266..9280
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9314..9337
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9383..9397
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9578..9784
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9872..10072
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9896..9910
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9935..9949
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9992..10006
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    10034..10051
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409390"
     misc_feature    10136..10579
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    10646..10744
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    10886..11347
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11507..11605
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    11630..12091
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      12890
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccc cgaggaggag gaagatagtg tgggcatacc
     1861 cattggccgt ccaccgcaga ggccagcgcc caaacacgac tggctggacg aattggacgc
     1921 caatgagtac cacgtctatc atccaagtaa tgtctatgag ttggccaatt ccaagaatcc
     1981 ctgtgccagc aatcaatttc gctgcgccac cacgaatgtg tgcatccccc tgcatttgcg
     2041 ttgcgataat ttctatcact gcaacgatat gagcgatgag aaggactgcg agcagtatca
     2101 acgacgcacc accaccacca cccgacgacc ttcgacctcg gcccggccct ccttcacctt
     2161 caccttcacg acccaggggc caggcttgct ggagcgtcgc aatagcacca ccagtagaac
     2221 caccgcaggc agcaccacca gagccaccga agcaccacaa tggccatggg caaccagacc
     2281 caccgagacc acgaccacta acccaataac aacagttggc gtagcgacca ccacacgact
     2341 aaagcccagc gactgcggtc cggatcagtt cttctgcgat gatttatgct ataatcgctc
     2401 tattcgatgc aatggccata tggattgctc agatggcagt gatgagatcg cttgtagctc
     2461 gctgtcagtg cttccatgtc cacagcacca gtgtcccagt ggcaggtgtt attcggaaag
     2521 tgagcgatgc gatcgccaca ggcactgcga ggatggctcc gatgaggcca actgctgtta
     2581 cgcggatcaa ttccgctgca ataatggtga ctgcattgcg gaatcggctc attgcgatgg
     2641 aaatatcgat tgtagcgacc agtccgatga actcgactgc ggaggagact cgcagtgtct
     2701 gcccaaccaa ttccgctgca agaatggcca atgtgtgagc tctacagcgc gttgcaacaa
     2761 gcgttccgat tgtttggatg gctccgatga gcagaattgt gccaatgaac ctaacaactc
     2821 cggacgtgga acgaaccaat tgaaactcaa gacctatccc gacaaccaaa tcattaagga
     2881 gagtcgtgag gtcatcttcc gttgccgtga cgaaggtccc aaccgcgcca aggtcaagtg
     2941 gtcgcgaccc ggcggacgtc ccctgccccc cggtttcacc gatcgcaatg gccgcctgga
     3001 gatccccaac atcagggtgg aggatgctgg cgcctatgtc tgcgaggccg tgggctatgc
     3061 caactatatt cccggtcagc acgtcaccgt aaacctcaac gtcgagcgct taaacgaacg
     3121 cgaaatccgt ccggactcag cctgtacgga gtaccaggcc acctgcatga acggcgagtg
     3181 tatcgataag tcgggcatct gcgatggaca tccggactgt tcggatggct ccgatgagca
     3241 cagctgcagt ttgggtttga agtgtcagcc caaccagttc atgtgctcca attccaagtg
     3301 tgtggatcgc acctggcgct gtgatggcga gaacgactgc ggcgataact ccgatgagac
     3361 ctcttgcgat ccggaaccaa gtgatgctcc gtgccgatac gacgaattcc agtgccgcag
     3421 cggtcattgc attcccaaga gcttccagtg cgactatatg aacgattgta ccgatggtac
     3481 cgatgaaatt ggatgctcgg tgccctctcc aatgacccta cccgcaccct cgattgtcgt
     3541 gatggagtac gaggtcctcg agctgacctg cgtgggcacc ggcgtcccga cgccgacgat
     3601 cgtgtggcgt ctcaactggg gccatgtgcc cgagaagtgt gaatcgaaga gctacggcgg
     3661 aaccggaacc ctgcgctgtc cgaacatgag gccccaggac agtggtgcct actcgtgcga
     3721 gttcatcaac acacgcggca ccttctatcc gaaaacgaac tcgattgtca ccgttacgcc
     3781 ggtgcgctcg gatgtctgca aggccggatt cttcaatatg ctggcccgca agtcggagga
     3841 atgcgtccag tgcttctgct ttggcgtttc gaccaactgt gacagtgcca atttgttcac
     3901 ctacgccatt cagccaccga tcctttcgca ccgcgtggtc agcgttgaac tcagtccgtt
     3961 ccgtcaaatt gtcatcaatg aggctagtcc gggtcaggat ctgctcacct tgcaccatgg
     4021 tgttcagttc agggcatcga acgtacacta caacggccgg gagacaccat tcttggccct
     4081 gcccgctgag tatatgggca accagctgaa gtcctatggc ggcaatctgc gctacgaggt
     4141 caggtacaat ggcaacggta gaccggtcag cggacccgat gtcatcatca ccggcaacag
     4201 tttcacgcta acccatcgcg ttcgcactca tccgggtcag aacaacaggg tgactattcc
     4261 cttcctgccg ggaggctgga cgaagccgga tggtcgcaag ggaacgcgag aggacatcat
     4321 gatgatactg gccaatgtgg acaatattct gattcgactg ggctacctgg atagcacagc
     4381 tcgcgaagtg gatctgataa atatcgcctt ggattcggcc ggaagtgccg atcagggatt
     4441 gggcagtgcc tcgctcgtgg agaagtgcac ctgtccgccc ggctatgttg gtgattcgtg
     4501 cgagtcctgt gcctcgggct atgttcgcca ggcccgcgga ccttggctgg gtcattgtgt
     4561 gcccttcacc ccggaaccgt gcccagcggg aacctacggc aatccccgac ttggtgttcc
     4621 ctgccaggag tgtccgtgcc cccacgcggg cgccaataac tttgccagcg gctgccaaca
     4681 gagtcccgat ggcgatgtga tttgccgctg caacgaaggc tatgccggca agaggtgcga
     4741 gcactgcgcc cagggttacc agggtaatcc gttggcaccg ggaggagtct gtcgcaagat
     4801 acccgatagt tcgtgcaatg tcgacggcac ctacaacatc tacagcaatg gaacgtgcca
     4861 gtgcaaggat agcgtgattg gcgaacagtg cgacacctgc gcgccgaaga gtttccacct
     4921 caattcgttc acctacaccg gttgcatcga gtgcttctgc agtggagtgg gcttggattg
     4981 tgacagtagt tcgtggtatc gcaaccaggt caccagcacc tttggacgaa cgcgcgtcaa
     5041 tcatggattc gccctgatta gcgactatat gcgcaatacc ccggtaacgg tgcccgtttc
     5101 catgtccacc caggccaatg ccttgagctt cgtgggatcc gccgagcagg ccggtaatac
     5161 gctctactgg agtcttcccg ccgccttcct gggcaacaag ctgacctcgt acggaggcaa
     5221 gttgagctac acgctcagct acagtcccct gcccagcggc attatgtcgc gcaacagtgc
     5281 ccccgatgtg gtgatcaaga gcggcgagga tctgaggctc atccattaca ggaagtcgca
     5341 ggtcagtccc agtgtggcca acacctatgc cgtggagatc aaggagagcg catggcagcg
     5401 cggcgatgaa ctggtgccta accgtgaaca cgtcctgatg gccctcagca atattacggc
     5461 catctatatc aaggccacgt acacgactag caccaaggag gcctcgctgc gatcggtcac
     5521 attggatacg gccacggcca ccaatctggg caccgcacgt gccgtcgaag tggagcagtg
     5581 ccgctgtccc gagggctatt tgggtctctc ctgcgagcag tgtgctcctg gctatacgcg
     5641 cgatccggag gcaggaatct atctgggtct ctgcaggccc tgcgagtgca atggacattc
     5701 caagtattgc aacagtgaga caggcgaatg cgaaagctgt tccgacaaca ccgaaggatt
     5761 caattgtgac cgatgcgccg ccggctatgt gggtgatgcc acccgaggaa cttcgtacga
     5821 ctgtcaatac gatgacggcg gctatccgac gtcgcgtcca ccggcaccgg gcaatcagac
     5881 ggccgaatgc ctggtgaatt gccaacagga gggaaccgcc ggttgccgcg gctaccagtg
     5941 cgagtgcaag aggaatgtgg ctggcgatcg atgcgatcag tgccgccccg gaacctatgg
     6001 actgtcggcc caaaatccgg acggttgcaa ggagtgctac tgctccggac tgaccaacca
     6061 gtgccgctcg gcgtctctct accgccagct gatacccgtg gacttcattt cgacgccacc
     6121 attgataaca gacgaattcg gcgacatcat ggatagggat aaccttgtgc ccgacgtgcc
     6181 caggaatgtg tatacctaca agcacacctc ctacacgccc aagtactgga gcctgagggg
     6241 tagtgtgctg ggcaaccagc tgttgtcgta cggcggccgc ttggagtaca gcctgattgt
     6301 ggagtccgtt ggccgggacc atcgtggcaa ggatgtggtc ctaattggca acggactcaa
     6361 gctgatctgg tcgcgacccg atggccatga caacgagcag gaataccatg tgcgtttgca
     6421 tgaggacgag cagtggacgg ttgaggatcg tggatcggca cgacaggcca cgcgggccga
     6481 cttcatgact gtgctgtcgg atctgcagca catcctgatc ctggccacac ccaaggtgcc
     6541 cacggtcagc acctcgatta gcaatgtcat cctggagagt tcgataacca cgagagcgcc
     6601 tggagctacg catgcctccg atatcgagtt gtgccagtgt ccatccggtt atacgggcac
     6661 ttcctgtgag tcctgcgcac cactgcacta ccgcgacgcc tctggacgct gcagtcagtg
     6721 tccttgcgac gcttccaaca cggaatcctg cggcttggtc agcggcggta acgtcgaatg
     6781 ccagtgcagg ccacgctgga ggggtgatcg ctgccgggaa attgaaacta acgaaccgac
     6841 tccggaaccg gataccagta ccgatgatcc cgtgcgcacc cagatcatag tgtcgattgc
     6901 caggccagag attaccattc tgcccgtggg tggatcgctg accctcagct gtaccggtcg
     6961 aatgcgctgg accaatagcc cagtgtttgt gaactggtac aagcagggca gtcacctgcc
     7021 cgagggagtc gaggtgcaag gcggtaatct gcagctgttc aacctgcaga tcagcgattc
     7081 tggaatctac atctgccagg ccgtaagcaa cgagaccggc cacagcttta cggaccacgt
     7141 ctccatcacc gtttcccagg aggaccaacg ctcgccggct cacattgtgg atttgcccaa
     7201 cgacgtgacc ttcgaggagt acgtaagcaa tgagatcgtc tgcgaggtgg agggcaaccc
     7261 accacccact gtcacctgga ctcgcgtgga tggccatgcg gacgcccaaa gtacgcgaac
     7321 ggacaacaat cggctggtct tcgattcgcc gaggaaatcg gacgagggtc gctatcgctg
     7381 ccaggcagag aatagcctga gtcgggagga gaagtacgta gtcgtgtatg tccggagcaa
     7441 tcctccccag ccgccgccgc agcaggatcg tttgtacatc acaccgcagg aggtgaacgg
     7501 tgtggccggt gactccttcc agttgtcctg ccaattcacc agcgctgcct ctctgcgcta
     7561 cgattggtcc cacgatggtc gctccctgtc cgcgtcgtca ccccgaaatg ttgtggtccg
     7621 cggaaatgtc ctggaagtcc gcgatgccaa cgttcgcgac tccggcacct acacctgtgt
     7681 ggccttcgac ctgcgcaccc gacgcaactt caccgagagc gcacgggtct acatcgagca
     7741 gcccaacgag ccgggaatcc ttggcgacaa gccgcatatc ttgaccttgg agcagaacat
     7801 cataattgtg caaggcgagg acttgagcat cacatgtgag gcaagtggaa cgccctatcc
     7861 ctcgattaag tggaccaagg tgcaggagaa tctggccgaa aatgtccgca tcagtggcaa
     7921 tgtgctcacc atctacggag gccgcagtga gaatcgtggt ctttactcct gcatcgccga
     7981 gaactctcac ggcagcgatc agtccagcac aagcatcgat attgaacccc gggagcggcc
     8041 gagtcttacg attgatacgg ccacccaaaa ggtttcggtt ggctcccagg cgtcccttta
     8101 ctgtgccgcc cagggcattc ccgaaccgac cgtcgagtgg gttcgaacgg atggtcagcc
     8161 actgtcgccg cgtcacaagg tccaggcacc cggctatgtt gtgatcgatg acattgtgct
     8221 cgatgatagc ggtacctacg agtgccgggc gagcaacata gctggccagg tgagcggctt
     8281 ggccaccatt aacgtccagg agccaactct tgtgcggatc gaaccagata ggcaacacca
     8341 tatcgtcacc cagggcgacg aactctcgct cagctgcgtg ggcagtggcg tccctactcc
     8401 ttcggtcttt tggagtttcg agggaagaga cgttgacagg atgggagtac cggaaggtgc
     8461 tgtttttgcg caacctttcc gaaccaacac tgccgacgtg aaaatcttcc gggtgagcaa
     8521 ggagaacgaa ggcatctacg tctgtcacgg atccaatgac gcgggtgaag atcaacaata
     8581 cattcgcgtg gaggtacaac ccagacgggg tgacgtcggt gcaggaggag atgacaatgg
     8641 tgatgtcgat acccgacagc cccccaatcg gccccaaatc caaccgaatc cattgagcaa
     8701 cgaacgcctg accaccgaat tgggcaacaa tgtgaccctc atctgcaacg tggacaacgt
     8761 gaacacggaa tgggaacgcg tcgatggcac acccctgccg cacaatgcct acacggtgag
     8821 aaatacgctg gtgattgtct tcgtggagcc gcagaatctg ggtcagtacc gctgcaatgg
     8881 aatcggtcgc gatggacgtg tggaggccca tgtggtgagg gagctggttc tcctgcccct
     8941 gcccaggatc accttctatc ccaacatccc gctgaccgtg gagctgggcc agaacttgga
     9001 tgtctactgc caggtggaga acgtgcgtcc ggaggacgtg cattggacca ccgacaacaa
     9061 tcgaccactg cccagttccg tacgcatcga gggcaatgtc ctcaggttcg cgtccatcac
     9121 tcaggctgct gccggtgaat accgctgctc ggccaccaat caatatggaa gccgatcgaa
     9181 gaacgccagg gtggtggtga aacagcccag tggcttccag cccgttcccc actcgcaggt
     9241 gcaacagcgt caggtgggcg actccatcca gttgcgatgc cgcctgacca cccagtacgg
     9301 cgacgaggtt cgcggcaata tccagttcaa ctggtaccgt gaggacggca gccccttgcc
     9361 ccgcggtgtc cgtccggata gccaggtgct gcagctggtt aaattgcagc ccgaggacga
     9421 gggccgctac atctgcaact cgtacgattt gggcagcggg cagcaactgc cccccgtctc
     9481 catcgacttg caagtactaa cggtaccagc ggctccccag aaccccatct acctgccgcc
     9541 agtggcgcca ccacgttcgc ccgaaaggat cctcgagccc caactgagcc tgagtgtaca
     9601 atcctcgaac ctgccagccg gcgacggcac caccgtcgag tgcttctcct ccgatgactc
     9661 ctacccagat gtcgtgtggg aacgcgccga tggagctcca ctcagcgaaa atgtccagca
     9721 agtgggcaat aacctggtga ttagtaacgt ggcctccacc gatgccggta actatgtgtg
     9781 caagtgcaag acggacgagg gagatctgta taccaccagc tacaaactgg aggtcgagga
     9841 gcagccccat gaactgaaga gctccaagat agtctacgcc aaggttggcg gaaatgccga
     9901 cttgcagtgc ggagccgatg aagatcgaca gcccagctac cgttggtctc gccaatacgg
     9961 acaacttcag gcgggacgca gtctgcagaa tgagaaactt tcgttggatc gcgttcaggc
    10021 caacgatgcc ggaacttatg tttgttcggc ccaatacagc gatggcgaga cggttgactt
    10081 ccccaacatt ctggttgtga ccggggcgat tccccagttc cgccaggagc cccgcagcta
    10141 catgagcttc cccacgctct cgaactcctc gttcaagttc aacttcgagc tgaccttccg
    10201 gccggaaaac gccgacggac tgctgctctt caatggacag acccgcggaa gcggtgacta
    10261 tatcgcactc tcgctgaagg atcgctatgc ggagttccgg ttcgattttg gcggtaaacc
    10321 gttgctggtg cgagcggagg agccactggc tttggatgaa tggcacacgg tgcgcgtgag
    10381 tcgcttcaag cgggatggct acatccaggt ggacgaccag catccggtgg ccttccccac
    10441 ctcccagcat cagcagatac cccagttgga actgattgag gatctgtaca ttggcggcgt
    10501 gcccaactgg gagttcctgc ccgccgaggc ggtgggtcag caatcaggct tcgtgggctg
    10561 cattagccgg ctgaccctgc agggacgcac cgtggagctg atccgggagg ccaagttcaa
    10621 ggagggcatc accgattgcc ggccctgcgc ccagggaccc tgccagaaca agggcgtctg
    10681 cctggagagc cagacggagc aggcctacac ctgcgtctgc cagccgggct ggactggccg
    10741 ggattgtgcc atcgagggca cccagtgcac cgcaggagtt tgcggctcgg gacgctgcga
    10801 gaatacggag aacgacatgg agtgcctgtg cccgctgaac agggcaggcg atcgatgcca
    10861 gtacaatgag attctaaatg aacagagctt gaatttcaag agcaacagct ttgcggccta
    10921 cggaactccc aaggtcacca aagtaaacat cacactctcc gttcgtcccg cgagcctgga
    10981 ggactctgtg atcctgtaca cggcggaatc cactctgccc agcggcgatt acctggcttt
    11041 ggtccttcgc ggtggccacg cggagctgct gatcaacacg gccgcccgct tggatcccgt
    11101 ggtggtgcgt tcggcggaac cgctgcccct caatcgctgg accagaatcg agatcaggcg
    11161 tcgcctgggc gagggaatcc tcaaggtggg cgatggaccc gagcgaaagg ccaaggcacc
    11221 gggatccgat cgcattctgt cgctcaagac ccacctcttt gtgggcggcg tcgatcggtc
    11281 gaccgtaaag atcaaccgtg atgtgaacat caccaagggc ttcgatggct gcatctcgaa
    11341 gctgtacaac tcgcagaaat ccgtcaatct gctgggtgac atcagggatg cggcgaatgt
    11401 ccagaactgt ggggaggcga atgagataga tgacgatgag tatgagatgc cagtagcgct
    11461 gccatcgcct aaggtcgccg agaatgaacg tcagctgatg gcgccgtgtg ccagtgatcc
    11521 ctgcgagaac gggggaagct gcagcgagca ggaggacatg gccatctgct cctgtccctt
    11581 cggcttcagc ggcaaacact gccagaatca cctccagctg agcttcaatg cctcgttccg
    11641 cggcgatggc tacgtggagc tgaaccgcag ccacttccaa cccgccctgg agcagacgta
    11701 ctcccacatt ggcattgtgt tcaccaccaa caagccgaat ggcctgcttt tctggtgggg
    11761 ccaggaggcc ggggaggagt acaccggaca ggacttcatt gccgccgccg tggtcgatgg
    11821 ctatgtggag tactcgatga ggctcgatgg cgaggaggcg gtcattcgga acagcgatat
    11881 ccgcgtggac aatggcgagc ggcacattgt gatcgccaag cgggatgaga acaccgccat
    11941 gctggaactc gatcagatcc tggacacggg cgatacgcga cccaccatca acaaggcaat
    12001 gaagctgccg ggcaatgtgt ttgtcggtgg cgctcctgat gtcgcggcat tcacgggctt
    12061 ccgctacaag gacaatttca acggctgcat tgtggtcgtc gagggcgaaa ccgtgggcca
    12121 aattaacctt agttcagctg ccatcaatgg agtgaatgcc aacgtgtgtc ccgctaacga
    12181 cgaacctctg ggaggaaccg aaccgccagt cgtctgagga cacaaccagc aaccgaaatt
    12241 agctttttaa ttaaacatta acaaatgaaa caaaaagaaa aacaattttt atatatacaa
    12301 catatgaata agccccaagc aaacctacaa aaaattgaat attatacgac gaacagataa
    12361 tataaaaaca aaaaaagaga gaaacgatca cttctactac aattgcttct tcgatcctta
    12421 agtctaggtt aaagattgta gcaagaaaac aagcgaatat cacaaacatt tatttaacaa
    12481 gaacgccatg cgagaagtga aacgaaacag aaacaataat gcaattaatg cagataatac
    12541 agataaagcc tagaacccta agaactaact aactaactcg aacaagaaca acaacgcata
    12601 ctagccaact gcaaccacaa caaccacaat agtgaaggca ttttaattat aattttagtc
    12661 tctagcttat aactatgact acgactcgtt ttttttgtga gcccagtgta aaatgttgga
    12721 aatcggaaat tggccctaca cacaaacaca cacaagttat taattaaata ccaattgata
    12781 ccatataatg ataaatgaaa tactatgaat gcaactattg tgaacgaacg aaaaccgttg
    12841 agtggataaa aagcataagc agaagatata ttaaaatgaa atcaacaaca