Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_044396086           12800 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X34, mRNA.
ACCESSION   XM_044396086
VERSION     XM_044396086.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..12800
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..12800
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..12127
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X33"
                     /protein_id="XP_044252021.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSEFDEDPIEVALP
                     TDEVEGSGQDSGSCRGDATFQCRRSGKTICDEMRCDGSRDCPDAEDEEGCEVCNELQF
                     KCDNKCLPLNKRCDNRYDCEDQTDEAGCQRYEVEESQPQPQPQPQPEPEPEPEPEPEP
                     EPEPEPEPEEPITDNEQPEQNSECRATEFRCNNGDCIDIRKRCDHISDCSEGEDENEE
                     CPAACSGMEYQCRDGTRCISLSQQCDGHSDCSDADDEEHCDGSGNDGEDCRFDEFRCG
                     TGECIPMRQVCDNIYDCNDYSDEVSCAEEEEDSVGIPIGRPPQRPAPKHDWLDELDAN
                     EYHVYHPSNVYELANSKNPCASNQFRCATTNVCIPLHLRCDNFYHCNDMSDEKDCEQY
                     QRRTTTTTRRPSTSARPSFTFTFTTQGPGLLERRNSTTSRTTAGSTTRATEAPQWPWA
                     TRPTETTTTNPITTVGVASCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDCGGDS
                     QCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKTYPDN
                     QIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGAYV
                     CEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGICDGHP
                     DCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSDA
                     PCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEYEVLE
                     LTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEFINTR
                     GTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLFTYAI
                     QPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPFLALP
                     AEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNNRVTI
                     PFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGSAD
                     QGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGTYGNP
                     RLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGNPLAP
                     GGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTGCIEC
                     FCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQANALS
                     FVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDVVIKS
                     GEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAIYIKA
                     TYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYTRDPE
                     AGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGTSYDC
                     QYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCRPGTY
                     GLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRDNLVP
                     DVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKDVVLI
                     GNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQHILI
                     LATPKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAPLHYR
                     DASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIETNEPTPEPDTSTDD
                     PVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGVEVQG
                     GNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPNDVTFE
                     EYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYRCQAE
                     NSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAASLRYD
                     WSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESARVYIE
                     QPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAENVRI
                     SGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKVSVGS
                     QASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECRASNI
                     AGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFEGRDV
                     DRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEVQPRR
                     GDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTEWERV
                     DGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLPRITF
                     YPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASITQAA
                     AGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTTQYGD
                     EVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQLPPV
                     SIDLQVLTVPAAPQNPIYLPPVAPPRSPERILEPQLSLSVQSSNLPAGDGTTVECFSS
                     DDSYPDVVWERADGAPLSENVQQVGNNLVISNVASTDAGNYVCKCKTDEGDLYTTSYK
                     LEVEEQPHELKSSKIVYAKVGGNADLQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKL
                     SLDRVQANDAGTYVCSAQYSDGETVDFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSF
                     KFNFELTFRPENADGLLLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPL
                     ALDEWHTVRVSRFKRDGYIQVDDQHPVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLP
                     AEAVGQQSGFVGCISRLTLQGRTVELIREAKFKEGITDCRPCAQGPCQNKGVCLESQT
                     EQAYTCVCQPGWTGRDCAIEGTQCTAGVCGSGRCENTENDMECLCPLNRAGDRCQYNE
                     ILNEQSLNFKSNSFAAYGTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALV
                     LRGGHAELLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGILKVGDGPERKAKA
                     PGSDRILSLKTHLFVGGVDRSTVKINRDVNITKGFDGCISKLYNSQKSVNLLGDIRDA
                     ANVQNCGEANEIDDDEYEMPVALPSPKVAENERQLMAPCASDPCENGGSCSEQEDMAI
                     CSCPFGFSGKHCQNHLQLSFNASFRGDGYVELNRSHFQPALEQTYSHIGIVFTTNKPN
                     GLLFWWGQEAGEEYTGQDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVI
                     AKRDENTAMLELDQILDTGDTRPTINKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGC
                     IVVVEGETVGQINLSSAAINGVNANVCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1268..1360
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1268..1270,1295..1297,1328..1333)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1307..1309,1316..1318,1328..1330,1346..1351)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1337..1351
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1367..1468
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1382..1384,1403..1405,1436..1441)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1415..1417,1424..1426,1436..1438,1454..1459)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1445..1459
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1625..1723
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1643..1645,1667..1669,1700..1705)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1679..1681,1688..1690,1700..1702,1718..1723)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1709..1723
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1745..1852
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1760..1762,1787..1789,1820..1825)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1799..1801,1808..1810,1820..1822,1838..1843)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1829..1843
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1880..1984
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1895..1897,1919..1921,1952..1957)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1931..1933,1940..1942,1952..1954,1970..1975)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1961..1975
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2138..2245
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2153..2155,2180..2182,2213..2218)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2192..2194,2201..2203,2213..2215,2231..2236)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2222..2236
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2486..2590
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2501..2503,2525..2527,2558..2563)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2537..2539,2546..2548,2558..2560,2576..2581)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2567..2581
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2606..2710
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2621..2623,2645..2647,2678..2683)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2657..2659,2666..2668,2678..2680,2696..2701)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2687..2701
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2753..2959
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    3053..3157
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3068..3070,3092..3094,3125..3130)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3104..3106,3113..3115,3125..3127,3143..3148)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3134..3148
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3173..3277
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3188..3190,3212..3214,3245..3250)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3224..3226,3233..3235,3245..3247,3263..3268)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3254..3268
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3302..3406
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3317..3319,3341..3343,3374..3379)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3353..3355,3362..3364,3374..3376,3392..3397)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3383..3397
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3458..3685
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    3467..3481
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:143220"
     misc_feature    3506..3520
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:143220"
     misc_feature    3575..3589
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:143220"
     misc_feature    3617..3634
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:143220"
     misc_feature    3659..3670
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:143220"
     misc_feature    3980..4372
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4541..4702
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(4541..4543,4547..4549,4583..4585,4613..4615,
                     4619..4621,4646..4648)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    4721..4834
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    5075..5485
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <5486..5566
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    5588..5737
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(5591..5593,5597..5599,5618..5620,5639..5641,
                     5648..5650,5675..5677)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <5846..5938
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    6134..6538
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6815..7063
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6848..6862
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6896..6910
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6953..6967
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    6995..7012
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    7040..7051
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <7142..7303
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    7394..7645
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7427..7441
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    7466..7480
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    7535..7549
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    7577..7594
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    7682..7924
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7733..7747
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    7772..7786
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    7829..7843
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    7871..7888
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    7910..7921
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    7976..8206
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    8000..8014
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409543"
     misc_feature    8039..8053
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409543"
     misc_feature    8144..8161
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409543"
     misc_feature    8183..8194
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409543"
     misc_feature    8243..8506
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8273..8287
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409548"
     misc_feature    8312..8326
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409548"
     misc_feature    8444..8461
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409548"
     misc_feature    8879..9109
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8906..8920
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409541"
     misc_feature    8945..8959
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409541"
     misc_feature    9005..9019
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409541"
     misc_feature    9047..9064
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409541"
     misc_feature    9143..>9346
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9176..9190
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9224..9247
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9293..9307
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9488..9694
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9782..9982
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9806..9820
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9845..9859
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9902..9916
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9944..9961
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409390"
     misc_feature    10046..10489
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    10556..10654
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    10796..11257
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11417..11515
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    11540..12001
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      12800
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgaattc gatgaggatc ctatcgaagt
     1201 tgcattgccc acggatgagg tggagggctc cggccaagat tccggtagct gtcgcggcga
     1261 tgccaccttc cagtgtcgaa ggagtggaaa gactatttgc gatgaaatgc gatgcgatgg
     1321 atctcgcgat tgtcccgatg ccgaggacga ggaaggctgc gaggtttgca acgaacttca
     1381 gttcaagtgc gataacaagt gtctgccgct caataagcgc tgcgataatc gatacgattg
     1441 tgaggatcag acggacgagg ctggttgtca acggtacgaa gtagaagagt ctcagcctca
     1501 gccgcagccg caacctcagc ctgaaccgga acctgaacct gaacctgagc ctgagcctga
     1561 acctgaacca gaaccagaac ctgaagagcc tataacagac aatgaacagc ctgagcaaaa
     1621 ctcagaatgc cgggccaccg agttcagatg caacaatggg gactgcatcg atattagaaa
     1681 gcgttgcgat cacatttcgg actgtagcga aggcgaggac gagaacgagg agtgccccgc
     1741 cgcctgcagc ggaatggagt atcaatgtcg cgacggcacg cgctgcataa gtttgagtca
     1801 gcagtgcgac ggtcattccg attgcagcga cgccgacgac gaggagcatt gcgacggaag
     1861 tggtaacgat ggtgaggatt gtcggttcga tgagttccgt tgcggaactg gtgagtgcat
     1921 accgatgcgt caggtgtgcg ataacatcta cgattgcaac gattattccg atgaggtcag
     1981 ctgcgccgag gaggaggaag atagtgtggg catacccatt ggccgtccac cgcagaggcc
     2041 agcgcccaaa cacgactggc tggacgaatt ggacgccaat gagtaccacg tctatcatcc
     2101 aagtaatgtc tatgagttgg ccaattccaa gaatccctgt gccagcaatc aatttcgctg
     2161 cgccaccacg aatgtgtgca tccccctgca tttgcgttgc gataatttct atcactgcaa
     2221 cgatatgagc gatgagaagg actgcgagca gtatcaacga cgcaccacca ccaccacccg
     2281 acgaccttcg acctcggccc ggccctcctt caccttcacc ttcacgaccc aggggccagg
     2341 cttgctggag cgtcgcaata gcaccaccag tagaaccacc gcaggcagca ccaccagagc
     2401 caccgaagca ccacaatggc catgggcaac cagacccacc gagaccacga ccactaaccc
     2461 aataacaaca gttggcgtag cgagctgtta cgcggatcaa ttccgctgca ataatggtga
     2521 ctgcattgcg gaatcggctc attgcgatgg aaatatcgat tgtagcgacc agtccgatga
     2581 actcgactgc ggaggagact cgcagtgtct gcccaaccaa ttccgctgca agaatggcca
     2641 atgtgtgagc tctacagcgc gttgcaacaa gcgttccgat tgtttggatg gctccgatga
     2701 gcagaattgt gccaatgaac ctaacaactc cggacgtgga acgaaccaat tgaaactcaa
     2761 gacctatccc gacaaccaaa tcattaagga gagtcgtgag gtcatcttcc gttgccgtga
     2821 cgaaggtccc aaccgcgcca aggtcaagtg gtcgcgaccc ggcggacgtc ccctgccccc
     2881 cggtttcacc gatcgcaatg gccgcctgga gatccccaac atcagggtgg aggatgctgg
     2941 cgcctatgtc tgcgaggccg tgggctatgc caactatatt cccggtcagc acgtcaccgt
     3001 aaacctcaac gtcgagcgct taaacgaacg cgaaatccgt ccggactcag cctgtacgga
     3061 gtaccaggcc acctgcatga acggcgagtg tatcgataag tcgggcatct gcgatggaca
     3121 tccggactgt tcggatggct ccgatgagca cagctgcagt ttgggtttga agtgtcagcc
     3181 caaccagttc atgtgctcca attccaagtg tgtggatcgc acctggcgct gtgatggcga
     3241 gaacgactgc ggcgataact ccgatgagac ctcttgcgat ccggaaccaa gtgatgctcc
     3301 gtgccgatac gacgaattcc agtgccgcag cggtcattgc attcccaaga gcttccagtg
     3361 cgactatatg aacgattgta ccgatggtac cgatgaaatt ggatgctcgg tgccctctcc
     3421 aatgacccta cccgcaccct cgattgtcgt gatggagtac gaggtcctcg agctgacctg
     3481 cgtgggcacc ggcgtcccga cgccgacgat cgtgtggcgt ctcaactggg gccatgtgcc
     3541 cgagaagtgt gaatcgaaga gctacggcgg aaccggaacc ctgcgctgtc cgaacatgag
     3601 gccccaggac agtggtgcct actcgtgcga gttcatcaac acacgcggca ccttctatcc
     3661 gaaaacgaac tcgattgtca ccgttacgcc ggtgcgctcg gatgtctgca aggccggatt
     3721 cttcaatatg ctggcccgca agtcggagga atgcgtccag tgcttctgct ttggcgtttc
     3781 gaccaactgt gacagtgcca atttgttcac ctacgccatt cagccaccga tcctttcgca
     3841 ccgcgtggtc agcgttgaac tcagtccgtt ccgtcaaatt gtcatcaatg aggctagtcc
     3901 gggtcaggat ctgctcacct tgcaccatgg tgttcagttc agggcatcga acgtacacta
     3961 caacggccgg gagacaccat tcttggccct gcccgctgag tatatgggca accagctgaa
     4021 gtcctatggc ggcaatctgc gctacgaggt caggtacaat ggcaacggta gaccggtcag
     4081 cggacccgat gtcatcatca ccggcaacag tttcacgcta acccatcgcg ttcgcactca
     4141 tccgggtcag aacaacaggg tgactattcc cttcctgccg ggaggctgga cgaagccgga
     4201 tggtcgcaag ggaacgcgag aggacatcat gatgatactg gccaatgtgg acaatattct
     4261 gattcgactg ggctacctgg atagcacagc tcgcgaagtg gatctgataa atatcgcctt
     4321 ggattcggcc ggaagtgccg atcagggatt gggcagtgcc tcgctcgtgg agaagtgcac
     4381 ctgtccgccc ggctatgttg gtgattcgtg cgagtcctgt gcctcgggct atgttcgcca
     4441 ggcccgcgga ccttggctgg gtcattgtgt gcccttcacc ccggaaccgt gcccagcggg
     4501 aacctacggc aatccccgac ttggtgttcc ctgccaggag tgtccgtgcc cccacgcggg
     4561 cgccaataac tttgccagcg gctgccaaca gagtcccgat ggcgatgtga tttgccgctg
     4621 caacgaaggc tatgccggca agaggtgcga gcactgcgcc cagggttacc agggtaatcc
     4681 gttggcaccg ggaggagtct gtcgcaagat acccgatagt tcgtgcaatg tcgacggcac
     4741 ctacaacatc tacagcaatg gaacgtgcca gtgcaaggat agcgtgattg gcgaacagtg
     4801 cgacacctgc gcgccgaaga gtttccacct caattcgttc acctacaccg gttgcatcga
     4861 gtgcttctgc agtggagtgg gcttggattg tgacagtagt tcgtggtatc gcaaccaggt
     4921 caccagcacc tttggacgaa cgcgcgtcaa tcatggattc gccctgatta gcgactatat
     4981 gcgcaatacc ccggtaacgg tgcccgtttc catgtccacc caggccaatg ccttgagctt
     5041 cgtgggatcc gccgagcagg ccggtaatac gctctactgg agtcttcccg ccgccttcct
     5101 gggcaacaag ctgacctcgt acggaggcaa gttgagctac acgctcagct acagtcccct
     5161 gcccagcggc attatgtcgc gcaacagtgc ccccgatgtg gtgatcaaga gcggcgagga
     5221 tctgaggctc atccattaca ggaagtcgca ggtcagtccc agtgtggcca acacctatgc
     5281 cgtggagatc aaggagagcg catggcagcg cggcgatgaa ctggtgccta accgtgaaca
     5341 cgtcctgatg gccctcagca atattacggc catctatatc aaggccacgt acacgactag
     5401 caccaaggag gcctcgctgc gatcggtcac attggatacg gccacggcca ccaatctggg
     5461 caccgcacgt gccgtcgaag tggagcagtg ccgctgtccc gagggctatt tgggtctctc
     5521 ctgcgagcag tgtgctcctg gctatacgcg cgatccggag gcaggaatct atctgggtct
     5581 ctgcaggccc tgcgagtgca atggacattc caagtattgc aacagtgaga caggcgaatg
     5641 cgaaagctgt tccgacaaca ccgaaggatt caattgtgac cgatgcgccg ccggctatgt
     5701 gggtgatgcc acccgaggaa cttcgtacga ctgtcaatac gatgacggcg gctatccgac
     5761 gtcgcgtcca ccggcaccgg gcaatcagac ggccgaatgc ctggtgaatt gccaacagga
     5821 gggaaccgcc ggttgccgcg gctaccagtg cgagtgcaag aggaatgtgg ctggcgatcg
     5881 atgcgatcag tgccgccccg gaacctatgg actgtcggcc caaaatccgg acggttgcaa
     5941 ggagtgctac tgctccggac tgaccaacca gtgccgctcg gcgtctctct accgccagct
     6001 gatacccgtg gacttcattt cgacgccacc attgataaca gacgaattcg gcgacatcat
     6061 ggatagggat aaccttgtgc ccgacgtgcc caggaatgtg tatacctaca agcacacctc
     6121 ctacacgccc aagtactgga gcctgagggg tagtgtgctg ggcaaccagc tgttgtcgta
     6181 cggcggccgc ttggagtaca gcctgattgt ggagtccgtt ggccgggacc atcgtggcaa
     6241 ggatgtggtc ctaattggca acggactcaa gctgatctgg tcgcgacccg atggccatga
     6301 caacgagcag gaataccatg tgcgtttgca tgaggacgag cagtggacgg ttgaggatcg
     6361 tggatcggca cgacaggcca cgcgggccga cttcatgact gtgctgtcgg atctgcagca
     6421 catcctgatc ctggccacac ccaaggtgcc cacggtcagc acctcgatta gcaatgtcat
     6481 cctggagagt tcgataacca cgagagcgcc tggagctacg catgcctccg atatcgagtt
     6541 gtgccagtgt ccatccggtt atacgggcac ttcctgtgag tcctgcgcac cactgcacta
     6601 ccgcgacgcc tctggacgct gcagtcagtg tccttgcgac gcttccaaca cggaatcctg
     6661 cggcttggtc agcggcggta acgtcgaatg ccagtgcagg ccacgctgga ggggtgatcg
     6721 ctgccgggaa attgaaacta acgaaccgac tccggaaccg gataccagta ccgatgatcc
     6781 cgtgcgcacc cagatcatag tgtcgattgc caggccagag attaccattc tgcccgtggg
     6841 tggatcgctg accctcagct gtaccggtcg aatgcgctgg accaatagcc cagtgtttgt
     6901 gaactggtac aagcagggca gtcacctgcc cgagggagtc gaggtgcaag gcggtaatct
     6961 gcagctgttc aacctgcaga tcagcgattc tggaatctac atctgccagg ccgtaagcaa
     7021 cgagaccggc cacagcttta cggaccacgt ctccatcacc gtttcccagg aggaccaacg
     7081 ctcgccggct cacattgtgg atttgcccaa cgacgtgacc ttcgaggagt acgtaagcaa
     7141 tgagatcgtc tgcgaggtgg agggcaaccc accacccact gtcacctgga ctcgcgtgga
     7201 tggccatgcg gacgcccaaa gtacgcgaac ggacaacaat cggctggtct tcgattcgcc
     7261 gaggaaatcg gacgagggtc gctatcgctg ccaggcagag aatagcctga gtcgggagga
     7321 gaagtacgta gtcgtgtatg tccggagcaa tcctccccag ccgccgccgc agcaggatcg
     7381 tttgtacatc acaccgcagg aggtgaacgg tgtggccggt gactccttcc agttgtcctg
     7441 ccaattcacc agcgctgcct ctctgcgcta cgattggtcc cacgatggtc gctccctgtc
     7501 cgcgtcgtca ccccgaaatg ttgtggtccg cggaaatgtc ctggaagtcc gcgatgccaa
     7561 cgttcgcgac tccggcacct acacctgtgt ggccttcgac ctgcgcaccc gacgcaactt
     7621 caccgagagc gcacgggtct acatcgagca gcccaacgag ccgggaatcc ttggcgacaa
     7681 gccgcatatc ttgaccttgg agcagaacat cataattgtg caaggcgagg acttgagcat
     7741 cacatgtgag gcaagtggaa cgccctatcc ctcgattaag tggaccaagg tgcaggagaa
     7801 tctggccgaa aatgtccgca tcagtggcaa tgtgctcacc atctacggag gccgcagtga
     7861 gaatcgtggt ctttactcct gcatcgccga gaactctcac ggcagcgatc agtccagcac
     7921 aagcatcgat attgaacccc gggagcggcc gagtcttacg attgatacgg ccacccaaaa
     7981 ggtttcggtt ggctcccagg cgtcccttta ctgtgccgcc cagggcattc ccgaaccgac
     8041 cgtcgagtgg gttcgaacgg atggtcagcc actgtcgccg cgtcacaagg tccaggcacc
     8101 cggctatgtt gtgatcgatg acattgtgct cgatgatagc ggtacctacg agtgccgggc
     8161 gagcaacata gctggccagg tgagcggctt ggccaccatt aacgtccagg agccaactct
     8221 tgtgcggatc gaaccagata ggcaacacca tatcgtcacc cagggcgacg aactctcgct
     8281 cagctgcgtg ggcagtggcg tccctactcc ttcggtcttt tggagtttcg agggaagaga
     8341 cgttgacagg atgggagtac cggaaggtgc tgtttttgcg caacctttcc gaaccaacac
     8401 tgccgacgtg aaaatcttcc gggtgagcaa ggagaacgaa ggcatctacg tctgtcacgg
     8461 atccaatgac gcgggtgaag atcaacaata cattcgcgtg gaggtacaac ccagacgggg
     8521 tgacgtcggt gcaggaggag atgacaatgg tgatgtcgat acccgacagc cccccaatcg
     8581 gccccaaatc caaccgaatc cattgagcaa cgaacgcctg accaccgaat tgggcaacaa
     8641 tgtgaccctc atctgcaacg tggacaacgt gaacacggaa tgggaacgcg tcgatggcac
     8701 acccctgccg cacaatgcct acacggtgag aaatacgctg gtgattgtct tcgtggagcc
     8761 gcagaatctg ggtcagtacc gctgcaatgg aatcggtcgc gatggacgtg tggaggccca
     8821 tgtggtgagg gagctggttc tcctgcccct gcccaggatc accttctatc ccaacatccc
     8881 gctgaccgtg gagctgggcc agaacttgga tgtctactgc caggtggaga acgtgcgtcc
     8941 ggaggacgtg cattggacca ccgacaacaa tcgaccactg cccagttccg tacgcatcga
     9001 gggcaatgtc ctcaggttcg cgtccatcac tcaggctgct gccggtgaat accgctgctc
     9061 ggccaccaat caatatggaa gccgatcgaa gaacgccagg gtggtggtga aacagcccag
     9121 tggcttccag cccgttcccc actcgcaggt gcaacagcgt caggtgggcg actccatcca
     9181 gttgcgatgc cgcctgacca cccagtacgg cgacgaggtt cgcggcaata tccagttcaa
     9241 ctggtaccgt gaggacggca gccccttgcc ccgcggtgtc cgtccggata gccaggtgct
     9301 gcagctggtt aaattgcagc ccgaggacga gggccgctac atctgcaact cgtacgattt
     9361 gggcagcggg cagcaactgc cccccgtctc catcgacttg caagtactaa cggtaccagc
     9421 ggctccccag aaccccatct acctgccgcc agtggcgcca ccacgttcgc ccgaaaggat
     9481 cctcgagccc caactgagcc tgagtgtaca atcctcgaac ctgccagccg gcgacggcac
     9541 caccgtcgag tgcttctcct ccgatgactc ctacccagat gtcgtgtggg aacgcgccga
     9601 tggagctcca ctcagcgaaa atgtccagca agtgggcaat aacctggtga ttagtaacgt
     9661 ggcctccacc gatgccggta actatgtgtg caagtgcaag acggacgagg gagatctgta
     9721 taccaccagc tacaaactgg aggtcgagga gcagccccat gaactgaaga gctccaagat
     9781 agtctacgcc aaggttggcg gaaatgccga cttgcagtgc ggagccgatg aagatcgaca
     9841 gcccagctac cgttggtctc gccaatacgg acaacttcag gcgggacgca gtctgcagaa
     9901 tgagaaactt tcgttggatc gcgttcaggc caacgatgcc ggaacttatg tttgttcggc
     9961 ccaatacagc gatggcgaga cggttgactt ccccaacatt ctggttgtga ccggggcgat
    10021 tccccagttc cgccaggagc cccgcagcta catgagcttc cccacgctct cgaactcctc
    10081 gttcaagttc aacttcgagc tgaccttccg gccggaaaac gccgacggac tgctgctctt
    10141 caatggacag acccgcggaa gcggtgacta tatcgcactc tcgctgaagg atcgctatgc
    10201 ggagttccgg ttcgattttg gcggtaaacc gttgctggtg cgagcggagg agccactggc
    10261 tttggatgaa tggcacacgg tgcgcgtgag tcgcttcaag cgggatggct acatccaggt
    10321 ggacgaccag catccggtgg ccttccccac ctcccagcat cagcagatac cccagttgga
    10381 actgattgag gatctgtaca ttggcggcgt gcccaactgg gagttcctgc ccgccgaggc
    10441 ggtgggtcag caatcaggct tcgtgggctg cattagccgg ctgaccctgc agggacgcac
    10501 cgtggagctg atccgggagg ccaagttcaa ggagggcatc accgattgcc ggccctgcgc
    10561 ccagggaccc tgccagaaca agggcgtctg cctggagagc cagacggagc aggcctacac
    10621 ctgcgtctgc cagccgggct ggactggccg ggattgtgcc atcgagggca cccagtgcac
    10681 cgcaggagtt tgcggctcgg gacgctgcga gaatacggag aacgacatgg agtgcctgtg
    10741 cccgctgaac agggcaggcg atcgatgcca gtacaatgag attctaaatg aacagagctt
    10801 gaatttcaag agcaacagct ttgcggccta cggaactccc aaggtcacca aagtaaacat
    10861 cacactctcc gttcgtcccg cgagcctgga ggactctgtg atcctgtaca cggcggaatc
    10921 cactctgccc agcggcgatt acctggcttt ggtccttcgc ggtggccacg cggagctgct
    10981 gatcaacacg gccgcccgct tggatcccgt ggtggtgcgt tcggcggaac cgctgcccct
    11041 caatcgctgg accagaatcg agatcaggcg tcgcctgggc gagggaatcc tcaaggtggg
    11101 cgatggaccc gagcgaaagg ccaaggcacc gggatccgat cgcattctgt cgctcaagac
    11161 ccacctcttt gtgggcggcg tcgatcggtc gaccgtaaag atcaaccgtg atgtgaacat
    11221 caccaagggc ttcgatggct gcatctcgaa gctgtacaac tcgcagaaat ccgtcaatct
    11281 gctgggtgac atcagggatg cggcgaatgt ccagaactgt ggggaggcga atgagataga
    11341 tgacgatgag tatgagatgc cagtagcgct gccatcgcct aaggtcgccg agaatgaacg
    11401 tcagctgatg gcgccgtgtg ccagtgatcc ctgcgagaac gggggaagct gcagcgagca
    11461 ggaggacatg gccatctgct cctgtccctt cggcttcagc ggcaaacact gccagaatca
    11521 cctccagctg agcttcaatg cctcgttccg cggcgatggc tacgtggagc tgaaccgcag
    11581 ccacttccaa cccgccctgg agcagacgta ctcccacatt ggcattgtgt tcaccaccaa
    11641 caagccgaat ggcctgcttt tctggtgggg ccaggaggcc ggggaggagt acaccggaca
    11701 ggacttcatt gccgccgccg tggtcgatgg ctatgtggag tactcgatga ggctcgatgg
    11761 cgaggaggcg gtcattcgga acagcgatat ccgcgtggac aatggcgagc ggcacattgt
    11821 gatcgccaag cgggatgaga acaccgccat gctggaactc gatcagatcc tggacacggg
    11881 cgatacgcga cccaccatca acaaggcaat gaagctgccg ggcaatgtgt ttgtcggtgg
    11941 cgctcctgat gtcgcggcat tcacgggctt ccgctacaag gacaatttca acggctgcat
    12001 tgtggtcgtc gagggcgaaa ccgtgggcca aattaacctt agttcagctg ccatcaatgg
    12061 agtgaatgcc aacgtgtgtc ccgctaacga cgaacctctg ggaggaaccg aaccgccagt
    12121 cgtctgagga cacaaccagc aaccgaaatt agctttttaa ttaaacatta acaaatgaaa
    12181 caaaaagaaa aacaattttt atatatacaa catatgaata agccccaagc aaacctacaa
    12241 aaaattgaat attatacgac gaacagataa tataaaaaca aaaaaagaga gaaacgatca
    12301 cttctactac aattgcttct tcgatcctta agtctaggtt aaagattgta gcaagaaaac
    12361 aagcgaatat cacaaacatt tatttaacaa gaacgccatg cgagaagtga aacgaaacag
    12421 aaacaataat gcaattaatg cagataatac agataaagcc tagaacccta agaactaact
    12481 aactaactcg aacaagaaca acaacgcata ctagccaact gcaaccacaa caaccacaat
    12541 agtgaaggca ttttaattat aattttagtc tctagcttat aactatgact acgactcgtt
    12601 ttttttgtga gcccagtgta aaatgttgga aatcggaaat tggccctaca cacaaacaca
    12661 cacaagttat taattaaata ccaattgata ccatataatg ataaatgaaa tactatgaat
    12721 gcaactattg tgaacgaacg aaaaccgttg agtggataaa aagcataagc agaagatata
    12781 ttaaaatgaa atcaacaaca