Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii terribly reduced optic lobes


LOCUS       XM_044396081           12725 bp    mRNA    linear   INV 09-DEC-2024
            (trol), transcript variant X25, mRNA.
ACCESSION   XM_044396081
VERSION     XM_044396081.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..12725
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..12725
                     /gene="trol"
                     /note="terribly reduced optic lobes; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:108055788"
     CDS             209..12052
                     /gene="trol"
                     /codon_start=1
                     /product="basement membrane-specific heparan sulfate
                     proteoglycan core protein isoform X25"
                     /protein_id="XP_044252016.1"
                     /db_xref="GeneID:108055788"
                     /translation="MGSPGSQAPAIAIGISNGRRGHTGSLLLRLLLVAFVLNACHVPP
                     TNAKQITKSKVDDQDFILADTQSLQGSVDLDDDEAFLIPPDSEEKLDKKFTPEGNWWS
                     QGLHRVRRSLNSFFGSDDDDQEKERERQRQRQNNRDAANRQKELRRQQKESQNREKQL
                     RLERQERQRLAKRNNHVVFNRVTDPRKRASDLYDENEASGLNEEETTTYRTYFVVNEP
                     YSDDYKERDSLQFQNLQKLLDEDLRNFFNRNFENNDDEEQEIHSTLERVDQTKDHFKI
                     RVQLRVDLPSSINDFGSKLEQQLNVYKRIDRLGASTDGVFTFTESSVYKYEHQYDIVT
                     PRVIVSGQPITEKPVEAPQEFDEDPIEVALPTDEVEGSGQDSGSCRGDATFQCRRSGK
                     TICDEMRCDGSRDCPDAEDEEGCEVCNELQFKCDNKCLPLNKRCDNRYDCEDQTDEAG
                     CQRYEVEESQPQPQPQPQPEPEPEPEPEPEPEPEPEPEPEEPITDNEQPEQNSECRAT
                     EFRCNNGDCIDIRKRCDHISDCSEGEDENEECRSSPQSSCLENIEFACHNRDCIPIES
                     VCDGTPDCGRSEDEDDALCKCTADKYKCQHGGGCIPKTQVCDGKPQCRDRSDESACPT
                     TRLKPSDCGPDQFFCDDLCYNRSIRCNGHMDCSDGSDEIACSSLSVLPCPQHQCPSGR
                     CYSESERCDRHRHCEDGSDEANCCYADQFRCNNGDCIAESAHCDGNIDCSDQSDELDC
                     GGDSQCLPNQFRCKNGQCVSSTARCNKRSDCLDGSDEQNCANEPNNSGRGTNQLKLKT
                     YPDNQIIKESREVIFRCRDEGPNRAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDA
                     GAYVCEAVGYANYIPGQHVTVNLNVERLNEREIRPDSACTEYQATCMNGECIDKSGIC
                     DGHPDCSDGSDEHSCSLGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPE
                     PSDAPCRYDEFQCRSGHCIPKSFQCDYMNDCTDGTDEIGCSVPSPMTLPAPSIVVMEY
                     EVLELTCVGTGVPTPTIVWRLNWGHVPEKCESKSYGGTGTLRCPNMRPQDSGAYSCEF
                     INTRGTFYPKTNSIVTVTPVRSDVCKAGFFNMLARKSEECVQCFCFGVSTNCDSANLF
                     TYAIQPPILSHRVVSVELSPFRQIVINEASPGQDLLTLHHGVQFRASNVHYNGRETPF
                     LALPAEYMGNQLKSYGGNLRYEVRYNGNGRPVSGPDVIITGNSFTLTHRVRTHPGQNN
                     RVTIPFLPGGWTKPDGRKGTREDIMMILANVDNILIRLGYLDSTAREVDLINIALDSA
                     GSADQGLGSASLVEKCTCPPGYVGDSCESCASGYVRQARGPWLGHCVPFTPEPCPAGT
                     YGNPRLGVPCQECPCPHAGANNFASGCQQSPDGDVICRCNEGYAGKRCEHCAQGYQGN
                     PLAPGGVCRKIPDSSCNVDGTYNIYSNGTCQCKDSVIGEQCDTCAPKSFHLNSFTYTG
                     CIECFCSGVGLDCDSSSWYRNQVTSTFGRTRVNHGFALISDYMRNTPVTVPVSMSTQA
                     NALSFVGSAEQAGNTLYWSLPAAFLGNKLTSYGGKLSYTLSYSPLPSGIMSRNSAPDV
                     VIKSGEDLRLIHYRKSQVSPSVANTYAVEIKESAWQRGDELVPNREHVLMALSNITAI
                     YIKATYTTSTKEASLRSVTLDTATATNLGTARAVEVEQCRCPEGYLGLSCEQCAPGYT
                     RDPEAGIYLGLCRPCECNGHSKYCNSETGECESCSDNTEGFNCDRCAAGYVGDATRGT
                     SYDCQYDDGGYPTSRPPAPGNQTAECLVNCQQEGTAGCRGYQCECKRNVAGDRCDQCR
                     PGTYGLSAQNPDGCKECYCSGLTNQCRSASLYRQLIPVDFISTPPLITDEFGDIMDRD
                     NLVPDVPRNVYTYKHTSYTPKYWSLRGSVLGNQLLSYGGRLEYSLIVESVGRDHRGKD
                     VVLIGNGLKLIWSRPDGHDNEQEYHVRLHEDEQWTVEDRGSARQATRADFMTVLSDLQ
                     HILILATPKVPTVSTSISNVILESSITTRAPGATHASDIELCQCPSGYTGTSCESCAP
                     LHYRDASGRCSQCPCDASNTESCGLVSGGNVECQCRPRWRGDRCREIETNEPTPEPDT
                     STDDPVRTQIIVSIARPEITILPVGGSLTLSCTGRMRWTNSPVFVNWYKQGSHLPEGV
                     EVQGGNLQLFNLQISDSGIYICQAVSNETGHSFTDHVSITVSQEDQRSPAHIVDLPND
                     VTFEEYVSNEIVCEVEGNPPPTVTWTRVDGHADAQSTRTDNNRLVFDSPRKSDEGRYR
                     CQAENSLSREEKYVVVYVRSNPPQPPPQQDRLYITPQEVNGVAGDSFQLSCQFTSAAS
                     LRYDWSHDGRSLSASSPRNVVVRGNVLEVRDANVRDSGTYTCVAFDLRTRRNFTESAR
                     VYIEQPNEPGILGDKPHILTLEQNIIIVQGEDLSITCEASGTPYPSIKWTKVQENLAE
                     NVRISGNVLTIYGGRSENRGLYSCIAENSHGSDQSSTSIDIEPRERPSLTIDTATQKV
                     SVGSQASLYCAAQGIPEPTVEWVRTDGQPLSPRHKVQAPGYVVIDDIVLDDSGTYECR
                     ASNIAGQVSGLATINVQEPTLVRIEPDRQHHIVTQGDELSLSCVGSGVPTPSVFWSFE
                     GRDVDRMGVPEGAVFAQPFRTNTADVKIFRVSKENEGIYVCHGSNDAGEDQQYIRVEV
                     QPRRGDVGAGGDDNGDVDTRQPPNRPQIQPNPLSNERLTTELGNNVTLICNVDNVNTE
                     WERVDGTPLPHNAYTVRNTLVIVFVEPQNLGQYRCNGIGRDGRVEAHVVRELVLLPLP
                     RITFYPNIPLTVELGQNLDVYCQVENVRPEDVHWTTDNNRPLPSSVRIEGNVLRFASI
                     TQAAAGEYRCSATNQYGSRSKNARVVVKQPSGFQPVPHSQVQQRQVGDSIQLRCRLTT
                     QYGDEVRGNIQFNWYREDGSPLPRGVRPDSQVLQLVKLQPEDEGRYICNSYDLGSGQQ
                     LPPVSIDLQVLRTTTQYPFNRFKGGVSLKDTPCMVLYICAAVPAAPQNPIYLPPVAPP
                     RSPERILEPQLSLSVQSSNLPAGDGTTVECFSSDDSYPDVVWERADGAPLSENVQQVG
                     NNLVISNVASTDAGNYVCKCKTDEGDLYTTSYKLEVEEQPHELKSSKIVYAKVGGNAD
                     LQCGADEDRQPSYRWSRQYGQLQAGRSLQNEKLSLDRVQANDAGTYVCSAQYSDGETV
                     DFPNILVVTGAIPQFRQEPRSYMSFPTLSNSSFKFNFELTFRPENADGLLLFNGQTRG
                     SGDYIALSLKDRYAEFRFDFGGKPLLVRAEEPLALDEWHTVRVSRFKRDGYIQVDDQH
                     PVAFPTSQHQQIPQLELIEDLYIGGVPNWEFLPAEAVGQQSGFVGCISRLTLQGRTVE
                     LIREAKFKEGITDCRPCAQGPCQNKGVCLESQTEQAYTCVCQPGWTGRDCAIEGTQCT
                     AGVCGSGRCENTENDMECLCPLNRAGDRCQYNEILNEQSLNFKSNSFAAYGTPKVTKV
                     NITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAELLINTAARLDPVVVRSAE
                     PLPLNRWTRIEIRRRLGEGILKVGDGPERKAKAPGSDRILSLKTHLFVGGVDRSTVKI
                     NRDVNITKGFDGCISKLYNSQKSVNLLGDIRDAANVQNCGEANEIDDDEYEMPVALPS
                     PKVAENERQLMAPCASDPCENGGSCSEQEDMAICSCPFGFSGKHCQNHLQLSFNASFR
                     GDGYVELNRSHFQPALEQTYSHIGIVFTTNKPNGLLFWWGQEAGEEYTGQDFIAAAVV
                     DGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAMLELDQILDTGDTRPTI
                     NKAMKLPGNVFVGGAPDVAAFTGFRYKDNFNGCIVVVEGETVGQINLSSAAINGVNAN
                     VCPANDEPLGGTEPPVV"
     misc_feature    458..>715
                     /gene="trol"
                     /note="Coiled-coil domain-containing protein 66; Region:
                     CCDC66; pfam15236"
                     /db_xref="CDD:434558"
     misc_feature    1361..1453
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1361..1363,1388..1390,1421..1426)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1400..1402,1409..1411,1421..1423,1439..1444)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1430..1444
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1460..1561
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1475..1477,1496..1498,1529..1534)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1508..1510,1517..1519,1529..1531,1547..1552)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1538..1552
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1718..1816
                     /gene="trol"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1736..1738,1760..1762,1793..1798)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1772..1774,1781..1783,1793..1795,1811..1816)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1802..1816
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1850..1954
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1868..1870,1892..1894,1925..1930)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1904..1906,1913..1915,1925..1927,1943..1948)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1934..1948
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1967..2074
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(1982..1984,2009..2011,2042..2047)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2021..2023,2030..2032,2042..2044,2060..2065)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2051..2065
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2102..2203
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2117..2119,2138..2140,2171..2176)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2150..2152,2159..2161,2171..2173,2189..2194)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2180..2194
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2231..2323
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2234..2236,2258..2260,2291..2296)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2270..2272,2279..2281,2291..2293,2309..2314)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2300..2314
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2324..2428
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2339..2341,2363..2365,2396..2401)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2375..2377,2384..2386,2396..2398,2414..2419)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2405..2419
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2444..2548
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2459..2461,2483..2485,2516..2521)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2495..2497,2504..2506,2516..2518,2534..2539)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2525..2539
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    2591..2797
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    2891..2995
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(2906..2908,2930..2932,2963..2968)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(2942..2944,2951..2953,2963..2965,2981..2986)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    2972..2986
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3011..3115
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3026..3028,3050..3052,3083..3088)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3062..3064,3071..3073,3083..3085,3101..3106)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3092..3106
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3140..3244
                     /gene="trol"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(3155..3157,3179..3181,3212..3217)
                     /gene="trol"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(3191..3193,3200..3202,3212..3214,3230..3235)
                     /gene="trol"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    3221..3235
                     /gene="trol"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    3296..3523
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    3305..3319
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:143220"
     misc_feature    3344..3358
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:143220"
     misc_feature    3413..3427
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:143220"
     misc_feature    3455..3472
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:143220"
     misc_feature    3497..3508
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:143220"
     misc_feature    3818..4210
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    4379..4540
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    order(4379..4381,4385..4387,4421..4423,4451..4453,
                     4457..4459,4484..4486)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    4559..4672
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domai;
                     Region: EGF_Lam; smart00180"
                     /db_xref="CDD:214543"
     misc_feature    4913..5323
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    <5324..5404
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    5426..5575
                     /gene="trol"
                     /note="Laminin-type epidermal growth factor-like domain;
                     laminins are the major noncollagenous components of
                     basement membranes that mediate cell adhesion, growth
                     migration, and differentiation; the laminin-type epidermal
                     growth factor-like module occurs in...; Region: EGF_Lam;
                     cd00055"
                     /db_xref="CDD:238012"
     misc_feature    order(5429..5431,5435..5437,5456..5458,5477..5479,
                     5486..5488,5513..5515)
                     /gene="trol"
                     /note="EGF-like motif [active]"
                     /db_xref="CDD:238012"
     misc_feature    <5684..5776
                     /gene="trol"
                     /note="Laminin EGF domain; Region: Laminin_EGF; pfam00053"
                     /db_xref="CDD:395007"
     misc_feature    5972..6376
                     /gene="trol"
                     /note="Laminin B (Domain IV); Region: Laminin_B;
                     pfam00052"
                     /db_xref="CDD:459652"
     misc_feature    6653..6901
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    6686..6700
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    6734..6748
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    6791..6805
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    6833..6850
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    6878..6889
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    <6980..7141
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    7232..7483
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    7265..7279
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    7304..7318
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    7373..7387
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    7415..7432
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    7520..7762
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
     misc_feature    7571..7585
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409570"
     misc_feature    7610..7624
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409570"
     misc_feature    7667..7681
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409570"
     misc_feature    7709..7726
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409570"
     misc_feature    7748..7759
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409570"
     misc_feature    7814..8044
                     /gene="trol"
                     /note="Immunoglobulin I-set domain; Region: I-set;
                     pfam07679"
                     /db_xref="CDD:400151"
     misc_feature    7838..7852
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409544"
     misc_feature    7877..7891
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409544"
     misc_feature    7940..7954
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409544"
     misc_feature    7982..7999
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409544"
     misc_feature    8021..8032
                     /gene="trol"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409544"
     misc_feature    8081..8344
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8111..8125
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409548"
     misc_feature    8150..8164
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409548"
     misc_feature    8282..8299
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409548"
     misc_feature    8717..8947
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    8744..8758
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409541"
     misc_feature    8783..8797
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409541"
     misc_feature    8843..8857
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409541"
     misc_feature    8885..8902
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409541"
     misc_feature    8981..>9184
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9014..9028
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9062..9085
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9131..9145
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9413..9619
                     /gene="trol"
                     /note="Immunoglobulin domain; Region: Ig_3; pfam13927"
                     /db_xref="CDD:464046"
     misc_feature    9707..9907
                     /gene="trol"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    9731..9745
                     /gene="trol"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409390"
     misc_feature    9770..9784
                     /gene="trol"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409390"
     misc_feature    9827..9841
                     /gene="trol"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409390"
     misc_feature    9869..9886
                     /gene="trol"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409390"
     misc_feature    9971..10414
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    10481..10579
                     /gene="trol"
                     /note="EGF-like domain; Region: EGF; pfam00008"
                     /db_xref="CDD:394967"
     misc_feature    10721..11182
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     misc_feature    11342..11440
                     /gene="trol"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    11465..11926
                     /gene="trol"
                     /note="Laminin G domain; Laminin G-like domains are
                     usually Ca++ mediated receptors that can have binding
                     sites for steroids, beta1 integrins, heparin, sulfatides,
                     fibulin-1, and alpha-dystroglycans. Proteins that contain
                     LamG domains serve a variety of...; Region: LamG; cd00110"
                     /db_xref="CDD:238058"
     polyA_site      12725
                     /gene="trol"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attaggttgc gcgccatcgt tccaggcggt cgcacattcc acgtgccata gccgtaacaa
       61 caacctgcca accgcttaaa accaaactca aatacgaacc gaaactgcct tcacacacac
      121 aagtacctaa accaaatcta aatagctgcc aaaagaaacc aaaaattcca gagacgtcgt
      181 agcatccgtt ccccggaaga agaagaagat gggatcgccg ggatcccaag cgcccgcgat
      241 cgcgatcggg atcagtaacg ggcggagagg tcacacgggg tcgctgctcc tgcgcctcct
      301 tctcgtggcc ttcgtcctca acgcctgcca cgtacccccg accaatgcca agcaaattac
      361 gaaaagtaaa gttgatgacc aggactttat actggccgac acacaatcgc tgcagggcag
      421 cgttgacctt gacgatgacg aagcgttcct gattcctccg gattccgaag agaagttgga
      481 taagaagttc acgccggagg gcaactggtg gagccagggg ctccatcgtg ttcgccgctc
      541 cctaaatagc ttcttcggct ccgacgacga tgatcaggaa aaggaacgtg agcgtcagag
      601 gcaaaggcaa aataatcgcg atgccgccaa ccggcaaaag gaacttcggc gccagcaaaa
      661 ggagagccag aaccgcgaga agcagctgcg attggagcgc caggagaggc agcgccttgc
      721 caagcggaac aatcacgtgg tcttcaatcg cgtcaccgat ccccgcaagc gggcatccga
      781 cctttacgac gagaacgagg catctggcct aaacgaggag gaaaccacca cctatcgcac
      841 ctactttgtt gttaatgagc catattcaga cgactacaag gagcgggaca gcctccagtt
      901 ccagaatctg caaaaacttc ttgacgagga cctgcgcaac ttcttcaatc gcaatttcga
      961 aaataacgat gatgaagagc aggaaatcca tagcacccta gagcgagtcg atcaaaccaa
     1021 ggaccatttt aaaattcgcg tgcaacttag ggtagatctg cccagttcaa tcaacgactt
     1081 tggaagtaag ttggagcaac aactgaatgt ctacaagcga atcgatcgtt tgggtgccag
     1141 taccgatggc gtcttcacct ttaccgaatc gagcgtctac aaatacgaac accaatacga
     1201 tattgtgaca ccgagagtaa ttgtatctgg acaaccgata actgaaaaac cagtcgaagc
     1261 accccaagaa ttcgatgagg atcctatcga agttgcattg cccacggatg aggtggaggg
     1321 ctccggccaa gattccggta gctgtcgcgg cgatgccacc ttccagtgtc gaaggagtgg
     1381 aaagactatt tgcgatgaaa tgcgatgcga tggatctcgc gattgtcccg atgccgagga
     1441 cgaggaaggc tgcgaggttt gcaacgaact tcagttcaag tgcgataaca agtgtctgcc
     1501 gctcaataag cgctgcgata atcgatacga ttgtgaggat cagacggacg aggctggttg
     1561 tcaacggtac gaagtagaag agtctcagcc tcagccgcag ccgcaacctc agcctgaacc
     1621 ggaacctgaa cctgaacctg agcctgagcc tgaacctgaa ccagaaccag aacctgaaga
     1681 gcctataaca gacaatgaac agcctgagca aaactcagaa tgccgggcca ccgagttcag
     1741 atgcaacaat ggggactgca tcgatattag aaagcgttgc gatcacattt cggactgtag
     1801 cgaaggcgag gacgagaacg aggagtgccg cagctcacct cagtcctcct gtctcgaaaa
     1861 catcgaattc gcgtgtcaca atcgcgattg cattccgatt gagagcgtct gcgatggcac
     1921 ccccgactgc ggacgcagtg aagacgagga cgacgctctt tgcaagtgca ccgccgacaa
     1981 gtacaaatgc caacacggcg gaggctgcat tccgaaaacc caggtgtgcg atggcaaacc
     2041 tcagtgccgc gaccgcagcg acgagagcgc ctgccccacc acacgactaa agcccagcga
     2101 ctgcggtccg gatcagttct tctgcgatga tttatgctat aatcgctcta ttcgatgcaa
     2161 tggccatatg gattgctcag atggcagtga tgagatcgct tgtagctcgc tgtcagtgct
     2221 tccatgtcca cagcaccagt gtcccagtgg caggtgttat tcggaaagtg agcgatgcga
     2281 tcgccacagg cactgcgagg atggctccga tgaggccaac tgctgttacg cggatcaatt
     2341 ccgctgcaat aatggtgact gcattgcgga atcggctcat tgcgatggaa atatcgattg
     2401 tagcgaccag tccgatgaac tcgactgcgg aggagactcg cagtgtctgc ccaaccaatt
     2461 ccgctgcaag aatggccaat gtgtgagctc tacagcgcgt tgcaacaagc gttccgattg
     2521 tttggatggc tccgatgagc agaattgtgc caatgaacct aacaactccg gacgtggaac
     2581 gaaccaattg aaactcaaga cctatcccga caaccaaatc attaaggaga gtcgtgaggt
     2641 catcttccgt tgccgtgacg aaggtcccaa ccgcgccaag gtcaagtggt cgcgacccgg
     2701 cggacgtccc ctgccccccg gtttcaccga tcgcaatggc cgcctggaga tccccaacat
     2761 cagggtggag gatgctggcg cctatgtctg cgaggccgtg ggctatgcca actatattcc
     2821 cggtcagcac gtcaccgtaa acctcaacgt cgagcgctta aacgaacgcg aaatccgtcc
     2881 ggactcagcc tgtacggagt accaggccac ctgcatgaac ggcgagtgta tcgataagtc
     2941 gggcatctgc gatggacatc cggactgttc ggatggctcc gatgagcaca gctgcagttt
     3001 gggtttgaag tgtcagccca accagttcat gtgctccaat tccaagtgtg tggatcgcac
     3061 ctggcgctgt gatggcgaga acgactgcgg cgataactcc gatgagacct cttgcgatcc
     3121 ggaaccaagt gatgctccgt gccgatacga cgaattccag tgccgcagcg gtcattgcat
     3181 tcccaagagc ttccagtgcg actatatgaa cgattgtacc gatggtaccg atgaaattgg
     3241 atgctcggtg ccctctccaa tgaccctacc cgcaccctcg attgtcgtga tggagtacga
     3301 ggtcctcgag ctgacctgcg tgggcaccgg cgtcccgacg ccgacgatcg tgtggcgtct
     3361 caactggggc catgtgcccg agaagtgtga atcgaagagc tacggcggaa ccggaaccct
     3421 gcgctgtccg aacatgaggc cccaggacag tggtgcctac tcgtgcgagt tcatcaacac
     3481 acgcggcacc ttctatccga aaacgaactc gattgtcacc gttacgccgg tgcgctcgga
     3541 tgtctgcaag gccggattct tcaatatgct ggcccgcaag tcggaggaat gcgtccagtg
     3601 cttctgcttt ggcgtttcga ccaactgtga cagtgccaat ttgttcacct acgccattca
     3661 gccaccgatc ctttcgcacc gcgtggtcag cgttgaactc agtccgttcc gtcaaattgt
     3721 catcaatgag gctagtccgg gtcaggatct gctcaccttg caccatggtg ttcagttcag
     3781 ggcatcgaac gtacactaca acggccggga gacaccattc ttggccctgc ccgctgagta
     3841 tatgggcaac cagctgaagt cctatggcgg caatctgcgc tacgaggtca ggtacaatgg
     3901 caacggtaga ccggtcagcg gacccgatgt catcatcacc ggcaacagtt tcacgctaac
     3961 ccatcgcgtt cgcactcatc cgggtcagaa caacagggtg actattccct tcctgccggg
     4021 aggctggacg aagccggatg gtcgcaaggg aacgcgagag gacatcatga tgatactggc
     4081 caatgtggac aatattctga ttcgactggg ctacctggat agcacagctc gcgaagtgga
     4141 tctgataaat atcgccttgg attcggccgg aagtgccgat cagggattgg gcagtgcctc
     4201 gctcgtggag aagtgcacct gtccgcccgg ctatgttggt gattcgtgcg agtcctgtgc
     4261 ctcgggctat gttcgccagg cccgcggacc ttggctgggt cattgtgtgc ccttcacccc
     4321 ggaaccgtgc ccagcgggaa cctacggcaa tccccgactt ggtgttccct gccaggagtg
     4381 tccgtgcccc cacgcgggcg ccaataactt tgccagcggc tgccaacaga gtcccgatgg
     4441 cgatgtgatt tgccgctgca acgaaggcta tgccggcaag aggtgcgagc actgcgccca
     4501 gggttaccag ggtaatccgt tggcaccggg aggagtctgt cgcaagatac ccgatagttc
     4561 gtgcaatgtc gacggcacct acaacatcta cagcaatgga acgtgccagt gcaaggatag
     4621 cgtgattggc gaacagtgcg acacctgcgc gccgaagagt ttccacctca attcgttcac
     4681 ctacaccggt tgcatcgagt gcttctgcag tggagtgggc ttggattgtg acagtagttc
     4741 gtggtatcgc aaccaggtca ccagcacctt tggacgaacg cgcgtcaatc atggattcgc
     4801 cctgattagc gactatatgc gcaatacccc ggtaacggtg cccgtttcca tgtccaccca
     4861 ggccaatgcc ttgagcttcg tgggatccgc cgagcaggcc ggtaatacgc tctactggag
     4921 tcttcccgcc gccttcctgg gcaacaagct gacctcgtac ggaggcaagt tgagctacac
     4981 gctcagctac agtcccctgc ccagcggcat tatgtcgcgc aacagtgccc ccgatgtggt
     5041 gatcaagagc ggcgaggatc tgaggctcat ccattacagg aagtcgcagg tcagtcccag
     5101 tgtggccaac acctatgccg tggagatcaa ggagagcgca tggcagcgcg gcgatgaact
     5161 ggtgcctaac cgtgaacacg tcctgatggc cctcagcaat attacggcca tctatatcaa
     5221 ggccacgtac acgactagca ccaaggaggc ctcgctgcga tcggtcacat tggatacggc
     5281 cacggccacc aatctgggca ccgcacgtgc cgtcgaagtg gagcagtgcc gctgtcccga
     5341 gggctatttg ggtctctcct gcgagcagtg tgctcctggc tatacgcgcg atccggaggc
     5401 aggaatctat ctgggtctct gcaggccctg cgagtgcaat ggacattcca agtattgcaa
     5461 cagtgagaca ggcgaatgcg aaagctgttc cgacaacacc gaaggattca attgtgaccg
     5521 atgcgccgcc ggctatgtgg gtgatgccac ccgaggaact tcgtacgact gtcaatacga
     5581 tgacggcggc tatccgacgt cgcgtccacc ggcaccgggc aatcagacgg ccgaatgcct
     5641 ggtgaattgc caacaggagg gaaccgccgg ttgccgcggc taccagtgcg agtgcaagag
     5701 gaatgtggct ggcgatcgat gcgatcagtg ccgccccgga acctatggac tgtcggccca
     5761 aaatccggac ggttgcaagg agtgctactg ctccggactg accaaccagt gccgctcggc
     5821 gtctctctac cgccagctga tacccgtgga cttcatttcg acgccaccat tgataacaga
     5881 cgaattcggc gacatcatgg atagggataa ccttgtgccc gacgtgccca ggaatgtgta
     5941 tacctacaag cacacctcct acacgcccaa gtactggagc ctgaggggta gtgtgctggg
     6001 caaccagctg ttgtcgtacg gcggccgctt ggagtacagc ctgattgtgg agtccgttgg
     6061 ccgggaccat cgtggcaagg atgtggtcct aattggcaac ggactcaagc tgatctggtc
     6121 gcgacccgat ggccatgaca acgagcagga ataccatgtg cgtttgcatg aggacgagca
     6181 gtggacggtt gaggatcgtg gatcggcacg acaggccacg cgggccgact tcatgactgt
     6241 gctgtcggat ctgcagcaca tcctgatcct ggccacaccc aaggtgccca cggtcagcac
     6301 ctcgattagc aatgtcatcc tggagagttc gataaccacg agagcgcctg gagctacgca
     6361 tgcctccgat atcgagttgt gccagtgtcc atccggttat acgggcactt cctgtgagtc
     6421 ctgcgcacca ctgcactacc gcgacgcctc tggacgctgc agtcagtgtc cttgcgacgc
     6481 ttccaacacg gaatcctgcg gcttggtcag cggcggtaac gtcgaatgcc agtgcaggcc
     6541 acgctggagg ggtgatcgct gccgggaaat tgaaactaac gaaccgactc cggaaccgga
     6601 taccagtacc gatgatcccg tgcgcaccca gatcatagtg tcgattgcca ggccagagat
     6661 taccattctg cccgtgggtg gatcgctgac cctcagctgt accggtcgaa tgcgctggac
     6721 caatagccca gtgtttgtga actggtacaa gcagggcagt cacctgcccg agggagtcga
     6781 ggtgcaaggc ggtaatctgc agctgttcaa cctgcagatc agcgattctg gaatctacat
     6841 ctgccaggcc gtaagcaacg agaccggcca cagctttacg gaccacgtct ccatcaccgt
     6901 ttcccaggag gaccaacgct cgccggctca cattgtggat ttgcccaacg acgtgacctt
     6961 cgaggagtac gtaagcaatg agatcgtctg cgaggtggag ggcaacccac cacccactgt
     7021 cacctggact cgcgtggatg gccatgcgga cgcccaaagt acgcgaacgg acaacaatcg
     7081 gctggtcttc gattcgccga ggaaatcgga cgagggtcgc tatcgctgcc aggcagagaa
     7141 tagcctgagt cgggaggaga agtacgtagt cgtgtatgtc cggagcaatc ctccccagcc
     7201 gccgccgcag caggatcgtt tgtacatcac accgcaggag gtgaacggtg tggccggtga
     7261 ctccttccag ttgtcctgcc aattcaccag cgctgcctct ctgcgctacg attggtccca
     7321 cgatggtcgc tccctgtccg cgtcgtcacc ccgaaatgtt gtggtccgcg gaaatgtcct
     7381 ggaagtccgc gatgccaacg ttcgcgactc cggcacctac acctgtgtgg ccttcgacct
     7441 gcgcacccga cgcaacttca ccgagagcgc acgggtctac atcgagcagc ccaacgagcc
     7501 gggaatcctt ggcgacaagc cgcatatctt gaccttggag cagaacatca taattgtgca
     7561 aggcgaggac ttgagcatca catgtgaggc aagtggaacg ccctatccct cgattaagtg
     7621 gaccaaggtg caggagaatc tggccgaaaa tgtccgcatc agtggcaatg tgctcaccat
     7681 ctacggaggc cgcagtgaga atcgtggtct ttactcctgc atcgccgaga actctcacgg
     7741 cagcgatcag tccagcacaa gcatcgatat tgaaccccgg gagcggccga gtcttacgat
     7801 tgatacggcc acccaaaagg tttcggttgg ctcccaggcg tccctttact gtgccgccca
     7861 gggcattccc gaaccgaccg tcgagtgggt tcgaacggat ggtcagccac tgtcgccgcg
     7921 tcacaaggtc caggcacccg gctatgttgt gatcgatgac attgtgctcg atgatagcgg
     7981 tacctacgag tgccgggcga gcaacatagc tggccaggtg agcggcttgg ccaccattaa
     8041 cgtccaggag ccaactcttg tgcggatcga accagatagg caacaccata tcgtcaccca
     8101 gggcgacgaa ctctcgctca gctgcgtggg cagtggcgtc cctactcctt cggtcttttg
     8161 gagtttcgag ggaagagacg ttgacaggat gggagtaccg gaaggtgctg tttttgcgca
     8221 acctttccga accaacactg ccgacgtgaa aatcttccgg gtgagcaagg agaacgaagg
     8281 catctacgtc tgtcacggat ccaatgacgc gggtgaagat caacaataca ttcgcgtgga
     8341 ggtacaaccc agacggggtg acgtcggtgc aggaggagat gacaatggtg atgtcgatac
     8401 ccgacagccc cccaatcggc cccaaatcca accgaatcca ttgagcaacg aacgcctgac
     8461 caccgaattg ggcaacaatg tgaccctcat ctgcaacgtg gacaacgtga acacggaatg
     8521 ggaacgcgtc gatggcacac ccctgccgca caatgcctac acggtgagaa atacgctggt
     8581 gattgtcttc gtggagccgc agaatctggg tcagtaccgc tgcaatggaa tcggtcgcga
     8641 tggacgtgtg gaggcccatg tggtgaggga gctggttctc ctgcccctgc ccaggatcac
     8701 cttctatccc aacatcccgc tgaccgtgga gctgggccag aacttggatg tctactgcca
     8761 ggtggagaac gtgcgtccgg aggacgtgca ttggaccacc gacaacaatc gaccactgcc
     8821 cagttccgta cgcatcgagg gcaatgtcct caggttcgcg tccatcactc aggctgctgc
     8881 cggtgaatac cgctgctcgg ccaccaatca atatggaagc cgatcgaaga acgccagggt
     8941 ggtggtgaaa cagcccagtg gcttccagcc cgttccccac tcgcaggtgc aacagcgtca
     9001 ggtgggcgac tccatccagt tgcgatgccg cctgaccacc cagtacggcg acgaggttcg
     9061 cggcaatatc cagttcaact ggtaccgtga ggacggcagc cccttgcccc gcggtgtccg
     9121 tccggatagc caggtgctgc agctggttaa attgcagccc gaggacgagg gccgctacat
     9181 ctgcaactcg tacgatttgg gcagcgggca gcaactgccc cccgtctcca tcgacttgca
     9241 agtactaaga actactaccc agtatccttt caatcggttt aagggcggtg tctccctgaa
     9301 agacacgccc tgcatggttc tgtatatttg tgcagcggta ccagcggctc cccagaaccc
     9361 catctacctg ccgccagtgg cgccaccacg ttcgcccgaa aggatcctcg agccccaact
     9421 gagcctgagt gtacaatcct cgaacctgcc agccggcgac ggcaccaccg tcgagtgctt
     9481 ctcctccgat gactcctacc cagatgtcgt gtgggaacgc gccgatggag ctccactcag
     9541 cgaaaatgtc cagcaagtgg gcaataacct ggtgattagt aacgtggcct ccaccgatgc
     9601 cggtaactat gtgtgcaagt gcaagacgga cgagggagat ctgtatacca ccagctacaa
     9661 actggaggtc gaggagcagc cccatgaact gaagagctcc aagatagtct acgccaaggt
     9721 tggcggaaat gccgacttgc agtgcggagc cgatgaagat cgacagccca gctaccgttg
     9781 gtctcgccaa tacggacaac ttcaggcggg acgcagtctg cagaatgaga aactttcgtt
     9841 ggatcgcgtt caggccaacg atgccggaac ttatgtttgt tcggcccaat acagcgatgg
     9901 cgagacggtt gacttcccca acattctggt tgtgaccggg gcgattcccc agttccgcca
     9961 ggagccccgc agctacatga gcttccccac gctctcgaac tcctcgttca agttcaactt
    10021 cgagctgacc ttccggccgg aaaacgccga cggactgctg ctcttcaatg gacagacccg
    10081 cggaagcggt gactatatcg cactctcgct gaaggatcgc tatgcggagt tccggttcga
    10141 ttttggcggt aaaccgttgc tggtgcgagc ggaggagcca ctggctttgg atgaatggca
    10201 cacggtgcgc gtgagtcgct tcaagcggga tggctacatc caggtggacg accagcatcc
    10261 ggtggccttc cccacctccc agcatcagca gataccccag ttggaactga ttgaggatct
    10321 gtacattggc ggcgtgccca actgggagtt cctgcccgcc gaggcggtgg gtcagcaatc
    10381 aggcttcgtg ggctgcatta gccggctgac cctgcaggga cgcaccgtgg agctgatccg
    10441 ggaggccaag ttcaaggagg gcatcaccga ttgccggccc tgcgcccagg gaccctgcca
    10501 gaacaagggc gtctgcctgg agagccagac ggagcaggcc tacacctgcg tctgccagcc
    10561 gggctggact ggccgggatt gtgccatcga gggcacccag tgcaccgcag gagtttgcgg
    10621 ctcgggacgc tgcgagaata cggagaacga catggagtgc ctgtgcccgc tgaacagggc
    10681 aggcgatcga tgccagtaca atgagattct aaatgaacag agcttgaatt tcaagagcaa
    10741 cagctttgcg gcctacggaa ctcccaaggt caccaaagta aacatcacac tctccgttcg
    10801 tcccgcgagc ctggaggact ctgtgatcct gtacacggcg gaatccactc tgcccagcgg
    10861 cgattacctg gctttggtcc ttcgcggtgg ccacgcggag ctgctgatca acacggccgc
    10921 ccgcttggat cccgtggtgg tgcgttcggc ggaaccgctg cccctcaatc gctggaccag
    10981 aatcgagatc aggcgtcgcc tgggcgaggg aatcctcaag gtgggcgatg gacccgagcg
    11041 aaaggccaag gcaccgggat ccgatcgcat tctgtcgctc aagacccacc tctttgtggg
    11101 cggcgtcgat cggtcgaccg taaagatcaa ccgtgatgtg aacatcacca agggcttcga
    11161 tggctgcatc tcgaagctgt acaactcgca gaaatccgtc aatctgctgg gtgacatcag
    11221 ggatgcggcg aatgtccaga actgtgggga ggcgaatgag atagatgacg atgagtatga
    11281 gatgccagta gcgctgccat cgcctaaggt cgccgagaat gaacgtcagc tgatggcgcc
    11341 gtgtgccagt gatccctgcg agaacggggg aagctgcagc gagcaggagg acatggccat
    11401 ctgctcctgt cccttcggct tcagcggcaa acactgccag aatcacctcc agctgagctt
    11461 caatgcctcg ttccgcggcg atggctacgt ggagctgaac cgcagccact tccaacccgc
    11521 cctggagcag acgtactccc acattggcat tgtgttcacc accaacaagc cgaatggcct
    11581 gcttttctgg tggggccagg aggccgggga ggagtacacc ggacaggact tcattgccgc
    11641 cgccgtggtc gatggctatg tggagtactc gatgaggctc gatggcgagg aggcggtcat
    11701 tcggaacagc gatatccgcg tggacaatgg cgagcggcac attgtgatcg ccaagcggga
    11761 tgagaacacc gccatgctgg aactcgatca gatcctggac acgggcgata cgcgacccac
    11821 catcaacaag gcaatgaagc tgccgggcaa tgtgtttgtc ggtggcgctc ctgatgtcgc
    11881 ggcattcacg ggcttccgct acaaggacaa tttcaacggc tgcattgtgg tcgtcgaggg
    11941 cgaaaccgtg ggccaaatta accttagttc agctgccatc aatggagtga atgccaacgt
    12001 gtgtcccgct aacgacgaac ctctgggagg aaccgaaccg ccagtcgtct gaggacacaa
    12061 ccagcaaccg aaattagctt tttaattaaa cattaacaaa tgaaacaaaa agaaaaacaa
    12121 tttttatata tacaacatat gaataagccc caagcaaacc tacaaaaaat tgaatattat
    12181 acgacgaaca gataatataa aaacaaaaaa agagagaaac gatcacttct actacaattg
    12241 cttcttcgat ccttaagtct aggttaaaga ttgtagcaag aaaacaagcg aatatcacaa
    12301 acatttattt aacaagaacg ccatgcgaga agtgaaacga aacagaaaca ataatgcaat
    12361 taatgcagat aatacagata aagcctagaa ccctaagaac taactaacta actcgaacaa
    12421 gaacaacaac gcatactagc caactgcaac cacaacaacc acaatagtga aggcatttta
    12481 attataattt tagtctctag cttataacta tgactacgac tcgttttttt tgtgagccca
    12541 gtgtaaaatg ttggaaatcg gaaattggcc ctacacacaa acacacacaa gttattaatt
    12601 aaataccaat tgataccata taatgataaa tgaaatacta tgaatgcaac tattgtgaac
    12661 gaacgaaaac cgttgagtgg ataaaaagca taagcagaag atatattaaa atgaaatcaa
    12721 caaca