Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044396077             430 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123002333), mRNA.
ACCESSION   XM_044396077
VERSION     XM_044396077.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..430
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..430
                     /gene="LOC123002333"
                     /note="uncharacterized LOC123002333; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:123002333"
     CDS             10..348
                     /gene="LOC123002333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044252012.1"
                     /db_xref="GeneID:123002333"
                     /translation="MTTSGLLSLPTPLVVALILSISLSLNLVTFAWADEFDVDYSNEY
                     DDVRPHLVYPDDPRLDKRIGDAAREFGQNITQAWHSMVDSFKNYFEELKSLFADTTDP
                     NAANEVFSNH"
     polyA_site      430
                     /gene="LOC123002333"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttggaaaaa tgactacttc cggacttctc agcctcccca ccccactagt tgtggccctg
       61 atcctcagca tcagcctctc gctcaacctg gtgaccttcg cctgggcgga tgagtttgat
      121 gtggactact ccaacgagta cgacgatgtg cgaccccatt tggtataccc cgacgatccg
      181 aggctggaca agcggatcgg cgatgcggcc cgggagtttg gccagaatat aacccaggcc
      241 tggcactcga tggtcgactc cttcaagaac tactttgagg agctcaagag tctgtttgcc
      301 gacaccacgg atcccaatgc agccaacgag gtcttttcta accactaaaa atatgacttc
      361 taatttttaa aataaagtgt attgcacaaa aataataaac caatataaca attaaatcta
      421 gagatcgtaa