Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396077 430 bp mRNA linear INV 09-DEC-2024 (LOC123002333), mRNA. ACCESSION XM_044396077 VERSION XM_044396077.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..430 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..430 /gene="LOC123002333" /note="uncharacterized LOC123002333; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:123002333" CDS 10..348 /gene="LOC123002333" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_044252012.1" /db_xref="GeneID:123002333" /translation="MTTSGLLSLPTPLVVALILSISLSLNLVTFAWADEFDVDYSNEY DDVRPHLVYPDDPRLDKRIGDAAREFGQNITQAWHSMVDSFKNYFEELKSLFADTTDP NAANEVFSNH" polyA_site 430 /gene="LOC123002333" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttggaaaaa tgactacttc cggacttctc agcctcccca ccccactagt tgtggccctg 61 atcctcagca tcagcctctc gctcaacctg gtgaccttcg cctgggcgga tgagtttgat 121 gtggactact ccaacgagta cgacgatgtg cgaccccatt tggtataccc cgacgatccg 181 aggctggaca agcggatcgg cgatgcggcc cgggagtttg gccagaatat aacccaggcc 241 tggcactcga tggtcgactc cttcaagaac tactttgagg agctcaagag tctgtttgcc 301 gacaccacgg atcccaatgc agccaacgag gtcttttcta accactaaaa atatgacttc 361 taatttttaa aataaagtgt attgcacaaa aataataaac caatataaca attaaatcta 421 gagatcgtaa