Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044396071 1770 bp mRNA linear INV 09-DEC-2024 (LOC108067448), mRNA. ACCESSION XM_044396071 VERSION XM_044396071.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044396071.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1770 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1770 /gene="LOC108067448" /note="uncharacterized LOC108067448; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108067448" CDS 324..1682 /gene="LOC108067448" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_044252006.1" /db_xref="GeneID:108067448" /translation="MSTQQEQLDYIERHLVYEIFKYFGSGVSLAGHRVECSTGLDGFM SALYTVQLDLVAGERSRTEVVLVKLMKGEKEFREQSNSYIQFANEVFAYAEILPAYEH LLRTSHLSSELVANWVPSCYFARFGLVRGLGSGRESVLALKHLKGDGYQLGPRLILRR DQLEAMVALIGPFHALGYATRILQPQVHARLRSGLLDMSFVSTSGKAGFDVLYRVAFD RFYEFYDRRREQLLRDSQADEGFSLAIERLREKYFDRPTHLLERIRTTSCESYFATFQ HGDFNRNNVLFHYGDDGQVDGIKTIDFQELRFSSTAIDLSFFMYMNTPSSGREEIFAD LLRKYHKRMIEMLELVLHRNRDELSDERVEQLLKDYSFERFEEHFKRYAFYGVMVCMH FMPWMLGSEPDCAELSRLCDTDMHGQAFYQLSLDIGGDAANEEIFKTVRHAYEHGYMD EI" misc_feature 444..1373 /gene="LOC108067448" /note="The protein kinase superfamily is mainly composed of the catalytic domains of serine/threonine-specific and tyrosine-specific protein kinases. It also includes RIO kinases, which are atypical serine protein kinases, aminoglycoside phosphotransferases; Region: Protein Kinases, catalytic domain; cl21453" /db_xref="CDD:473864" ORIGIN 1 gttgcggaat tcaaaaaacc aagtgatcgg attcggattg cgatttaacg gttcccgttc 61 ccgggttatc ttacgtggat cttaatgaat tttacccaga taatccccga ttttccctcc 121 agggaggggg gaggtggcaa gtggctacta cataagaagc gcccaccaat tgagatccca 181 attaacgcag taacgcagta actggttggt gttgctggag ctggaggacg ggtcgtttat 241 cggggattgg ggactggcgg tcgggtcaac gccccactgg ctcgtgaaag caatcaacaa 301 tcaactctcc tcgccattgc aaaatgtcga cgcagcaaga gcagttggac tacattgagc 361 ggcatctcgt ctacgagatc ttcaagtact tcggatcggg cgtctccctg gcgggccacc 421 gggtggagtg ctccaccggg ctggacggct tcatgtcggc cctgtacacg gtgcaactgg 481 atctggttgc cggcgaacgc agccgcaccg aggtcgtcct ggtcaagctg atgaagggcg 541 agaaggagtt ccgcgagcag agcaactcgt acatccagtt cgccaacgag gtgttcgcct 601 acgccgagat cctgcccgcc tacgagcatc tgctgcggac gagccacctg tccagcgagc 661 tggtggccaa ctgggtgccc agctgctact ttgcccggtt cggattggtc agaggtctcg 721 gcagcggtcg cgaatccgtg ctggccctca agcatctcaa gggcgacggc taccagttgg 781 gcccgcgcct catcctccgc cgcgatcaac tggaggccat ggtggctctg atcgggccct 841 tccatgccct gggctatgcc acccgcatcc tccagccgca ggtgcatgcc cgcctgcgct 901 cgggcctcct ggacatgtcc tttgtctcca cttcagggaa ggccggcttt gatgtgctct 961 atcgcgtggc cttcgatcgc ttctacgagt tctacgaccg ccggcgggag cagctcctca 1021 gggattcgca agcggatgag gggttttccc tggccatcga gcgtctgcgc gagaagtact 1081 tcgaccggcc aacgcatctg ctggagcgga ttcgcaccac gtcctgtgag agttattttg 1141 ccaccttcca gcacggcgac ttcaatcgca acaacgtgct cttccactac ggcgacgatg 1201 gccaggtgga tggcatcaag accatcgact tccaggagct gcgcttcagc tcgacggcca 1261 ttgacctgag cttcttcatg tacatgaaca cgccgtcctc gggcagggag gagatctttg 1321 cggatctgct gcggaagtac cacaaacgga tgatcgagat gctggaattg gttctgcatc 1381 gcaaccggga cgagctgagc gacgagcggg tggagcagct cttgaaggac tacagtttcg 1441 aacgattcga ggagcacttc aagcgatacg ccttctacgg ggtgatggtc tgcatgcact 1501 tcatgccctg gatgctgggc agcgagccgg attgcgccga gttgtcccgg ctctgcgaca 1561 cggacatgca tggccaggcc ttctatcagt tgtccctgga cattggcggc gacgcggcca 1621 acgaggagat cttcaagacg gtgcggcacg cctacgagca tggctacatg gacgagatat 1681 agattaaatc tacctgaatt ttatttacta tgcagttaac attgattttt taaaattttt 1741 acactttttg ttctcaaaag aaagcacaaa