Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii translation machinery-associated


LOCUS       XM_044395965             657 bp    mRNA    linear   INV 09-DEC-2024
            protein 16 homolog (LOC108054277), mRNA.
ACCESSION   XM_044395965
VERSION     XM_044395965.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044395965.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..657
                     /gene="LOC108054277"
                     /note="translation machinery-associated protein 16
                     homolog; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108054277"
     CDS             91..636
                     /gene="LOC108054277"
                     /codon_start=1
                     /product="translation machinery-associated protein 16
                     homolog"
                     /protein_id="XP_044251900.1"
                     /db_xref="GeneID:108054277"
                     /translation="MTNLRKELEKCKHPNSRKTKALGKKARRQNNKHKVRLGHAIKSN
                     LTGEKLSWFLGQIDEGRTEPLSPQELQDLIELYFTRFDEELEQINLKQSIGKHRANQH
                     AARKDVITMTLEKERNEFRSGGLELMNLCDPLKLKMLRDWDGSALSVQHLKLDLVSHN
                     MLQRLKEQSGSEEATSEQMET"
     misc_feature    115..564
                     /gene="LOC108054277"
                     /note="Translation machinery-associated protein 16;
                     Region: Tma16; pfam11176"
                     /db_xref="CDD:463236"
     polyA_site      657
                     /gene="LOC108054277"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 actagggatc cagctgatcg cacatgtgcc ttttaccaac gtttaccaac actgacacca
       61 aaacaacgtg aacatttcaa cggcgtaaaa atgacgaatc tgcgcaagga actggagaag
      121 tgtaagcacc cgaacagccg gaaaaccaag gcgctgggca aaaaggcgcg tcgccagaac
      181 aacaagcaca aggttcgttt gggccatgcg atcaaaagca acctgacggg cgagaaactg
      241 agctggttcc tgggccaaat cgacgaggga cgcaccgagc cgctgagtcc gcaggagctg
      301 caggatctca tcgagctgta cttcacccgg ttcgacgagg agctggagca gatcaacctg
      361 aagcagtcga tcggcaagca ccgggccaac cagcatgccg cccgcaagga tgtgatcacc
      421 atgacgctgg agaaggagcg caacgagttc cgctctggcg gcctggaact gatgaacctc
      481 tgcgatccgc tcaagctgaa aatgctacgc gactgggacg gcagtgcgct gagtgtgcag
      541 cacctgaagc tcgatctcgt ctcgcacaac atgctgcagc ggctcaagga gcagtccggg
      601 agcgaggaag ccaccagcga gcagatggaa acataaaata aataaaaata agaaaaa