Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044395965 657 bp mRNA linear INV 09-DEC-2024 protein 16 homolog (LOC108054277), mRNA. ACCESSION XM_044395965 VERSION XM_044395965.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044395965.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..657 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..657 /gene="LOC108054277" /note="translation machinery-associated protein 16 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108054277" CDS 91..636 /gene="LOC108054277" /codon_start=1 /product="translation machinery-associated protein 16 homolog" /protein_id="XP_044251900.1" /db_xref="GeneID:108054277" /translation="MTNLRKELEKCKHPNSRKTKALGKKARRQNNKHKVRLGHAIKSN LTGEKLSWFLGQIDEGRTEPLSPQELQDLIELYFTRFDEELEQINLKQSIGKHRANQH AARKDVITMTLEKERNEFRSGGLELMNLCDPLKLKMLRDWDGSALSVQHLKLDLVSHN MLQRLKEQSGSEEATSEQMET" misc_feature 115..564 /gene="LOC108054277" /note="Translation machinery-associated protein 16; Region: Tma16; pfam11176" /db_xref="CDD:463236" polyA_site 657 /gene="LOC108054277" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 actagggatc cagctgatcg cacatgtgcc ttttaccaac gtttaccaac actgacacca 61 aaacaacgtg aacatttcaa cggcgtaaaa atgacgaatc tgcgcaagga actggagaag 121 tgtaagcacc cgaacagccg gaaaaccaag gcgctgggca aaaaggcgcg tcgccagaac 181 aacaagcaca aggttcgttt gggccatgcg atcaaaagca acctgacggg cgagaaactg 241 agctggttcc tgggccaaat cgacgaggga cgcaccgagc cgctgagtcc gcaggagctg 301 caggatctca tcgagctgta cttcacccgg ttcgacgagg agctggagca gatcaacctg 361 aagcagtcga tcggcaagca ccgggccaac cagcatgccg cccgcaagga tgtgatcacc 421 atgacgctgg agaaggagcg caacgagttc cgctctggcg gcctggaact gatgaacctc 481 tgcgatccgc tcaagctgaa aatgctacgc gactgggacg gcagtgcgct gagtgtgcag 541 cacctgaagc tcgatctcgt ctcgcacaac atgctgcagc ggctcaagga gcagtccggg 601 agcgaggaag ccaccagcga gcagatggaa acataaaata aataaaaata agaaaaa