Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044395882 1107 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_044395882 VERSION XM_044395882.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044395882.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1107 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1107 /gene="Cp36" /note="Chorion protein 36; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:123003406" CDS 108..989 /gene="Cp36" /codon_start=1 /product="chorion protein S36" /protein_id="XP_044251817.1" /db_xref="GeneID:123003406" /translation="MQLGLWFGILAIAAAPLVSANYGPPAGHGHGHGHGGHGQYLAGP NAGLEEYVNVATGGNQPAANQIASQAEIQPSPEEARRLGRVQAQLQALNADPNYQKLK NSEDIAESLAETNLASNIRQGKIKVVSPQFVDQHLFRSLLVPSGHNNHQVIATQPLPP IIVHQPGAPPAHVNSGPPTVVRGNPVIYKIKPSVIYQQEVINKVPTPLSLNPVYVKVY KPGKKIEAPLAPVVAPVYSQPREYSQPREYSQPQGYGSAGAASSAAGAASSADGNGYG NEAPLYNSPAPYGQPNY" misc_feature 114..860 /gene="Cp36" /note="Chorion family 3; Region: Chorion_3; pfam05387" /db_xref="CDD:310175" polyA_site 1107 /gene="Cp36" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agatgcatca cgtagccggc cgtggcgggc agcgattata ggcgctataa agagccggag 61 tcatcgccag acagcgagca gtagacgatc cacacgtaaa cggcaacatg caactcggtc 121 tctggtttgg catcttagcc atcgccgcgg cgccgctggt gagcgctaac tatggtcccc 181 ccgctggaca tggacacggt catggacatg gtggacacgg tcagtatctg gcgggtccca 241 atgccggact cgaggagtac gtgaatgtgg cgacgggcgg caaccagccg gctgccaacc 301 agatcgcctc ccaggccgaa atccagccct cgccggagga ggcccgtcgt ctgggtcgcg 361 tccaggccca attgcaggcc ctcaacgccg atcccaacta ccagaagctg aagaactccg 421 aggatattgc cgagtctctc gcggagacca atttggccag caacattcgg cagggcaaga 481 tcaaggtggt ctccccgcag ttcgtcgatc agcatctgtt ccgctccctg ctggtgcctt 541 cgggccacaa caaccaccag gtgattgcca cccagcccct gcctccaatc attgtccacc 601 agccaggtgc accgccggcc catgtgaaca gcggcccacc gacggtggtg cgcggcaatc 661 cggtgatcta caagatcaag ccctcggtca tctaccagca ggaggtgatc aacaaggtgc 721 ccactccgct gagcctcaac cctgtctacg tgaaggtcta caagcccggc aagaagatcg 781 aggccccgct ggccccggtg gtggcccccg tctacagcca gccgagggag tacagccaac 841 ccagggagta cagccagccg cagggctatg gtagtgccgg agcagcttcc tccgccgccg 901 gtgccgcgtc atctgccgat ggcaatggct acggcaacga ggccccactg tacaacagtc 961 ccgcgcccta tggccagccc aactactagg tgctcatcct actcgcctac tcctcagctg 1021 cgacagctgg tttaatttaa atttttgttt ttttttcttt gccgactgct gagcgcaaat 1081 aaatgaaaaa aatacccaaa acgtaaa