Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Chorion protein 36 (Cp36), mRNA.


LOCUS       XM_044395882            1107 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_044395882
VERSION     XM_044395882.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044395882.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1107
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1107
                     /gene="Cp36"
                     /note="Chorion protein 36; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:123003406"
     CDS             108..989
                     /gene="Cp36"
                     /codon_start=1
                     /product="chorion protein S36"
                     /protein_id="XP_044251817.1"
                     /db_xref="GeneID:123003406"
                     /translation="MQLGLWFGILAIAAAPLVSANYGPPAGHGHGHGHGGHGQYLAGP
                     NAGLEEYVNVATGGNQPAANQIASQAEIQPSPEEARRLGRVQAQLQALNADPNYQKLK
                     NSEDIAESLAETNLASNIRQGKIKVVSPQFVDQHLFRSLLVPSGHNNHQVIATQPLPP
                     IIVHQPGAPPAHVNSGPPTVVRGNPVIYKIKPSVIYQQEVINKVPTPLSLNPVYVKVY
                     KPGKKIEAPLAPVVAPVYSQPREYSQPREYSQPQGYGSAGAASSAAGAASSADGNGYG
                     NEAPLYNSPAPYGQPNY"
     misc_feature    114..860
                     /gene="Cp36"
                     /note="Chorion family 3; Region: Chorion_3; pfam05387"
                     /db_xref="CDD:310175"
     polyA_site      1107
                     /gene="Cp36"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agatgcatca cgtagccggc cgtggcgggc agcgattata ggcgctataa agagccggag
       61 tcatcgccag acagcgagca gtagacgatc cacacgtaaa cggcaacatg caactcggtc
      121 tctggtttgg catcttagcc atcgccgcgg cgccgctggt gagcgctaac tatggtcccc
      181 ccgctggaca tggacacggt catggacatg gtggacacgg tcagtatctg gcgggtccca
      241 atgccggact cgaggagtac gtgaatgtgg cgacgggcgg caaccagccg gctgccaacc
      301 agatcgcctc ccaggccgaa atccagccct cgccggagga ggcccgtcgt ctgggtcgcg
      361 tccaggccca attgcaggcc ctcaacgccg atcccaacta ccagaagctg aagaactccg
      421 aggatattgc cgagtctctc gcggagacca atttggccag caacattcgg cagggcaaga
      481 tcaaggtggt ctccccgcag ttcgtcgatc agcatctgtt ccgctccctg ctggtgcctt
      541 cgggccacaa caaccaccag gtgattgcca cccagcccct gcctccaatc attgtccacc
      601 agccaggtgc accgccggcc catgtgaaca gcggcccacc gacggtggtg cgcggcaatc
      661 cggtgatcta caagatcaag ccctcggtca tctaccagca ggaggtgatc aacaaggtgc
      721 ccactccgct gagcctcaac cctgtctacg tgaaggtcta caagcccggc aagaagatcg
      781 aggccccgct ggccccggtg gtggcccccg tctacagcca gccgagggag tacagccaac
      841 ccagggagta cagccagccg cagggctatg gtagtgccgg agcagcttcc tccgccgccg
      901 gtgccgcgtc atctgccgat ggcaatggct acggcaacga ggccccactg tacaacagtc
      961 ccgcgcccta tggccagccc aactactagg tgctcatcct actcgcctac tcctcagctg
     1021 cgacagctgg tttaatttaa atttttgttt ttttttcttt gccgactgct gagcgcaaat
     1081 aaatgaaaaa aatacccaaa acgtaaa