Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044395861 448 bp mRNA linear INV 09-DEC-2024 (LOC123003405), mRNA. ACCESSION XM_044395861 VERSION XM_044395861.1 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..448 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..448 /gene="LOC123003405" /note="uncharacterized LOC123003405; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:123003405" CDS 128..433 /gene="LOC123003405" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_044251796.1" /db_xref="GeneID:123003405" /translation="MSQMLQLDALVMAMACLSTTQTDLGGGLMVPPSLENASSQSCPV SSLSGLTTRMQSLSREIDSVKEQIGSLQEQLVDLRRTGSPPVVALGSPNVLASRLWV" ORIGIN 1 tcgagtgacc tttgttttca ttcgcactag cattgtgcct ccgatcggta gttagtatct 61 agttggttac ttagttagtt agtcacgcag ttagctagtc cagtggccag tgaaagagag 121 taggaaaatg tcgcagatgc tccagctgga cgccttggtc atggccatgg cctgtctgtc 181 caccacgcaa acagatctgg gcggaggtct gatggtgccg ccctccttgg aaaatgcgag 241 ctcccagagt tgtcccgttt cgtccttgag tggcctgacc acccggatgc agtcgctgag 301 cagggagata gacagtgtaa aggagcaaat cggaagtctg caggagcagc tggtggatct 361 gcggagaacg ggaagtcccc cggtggtggc actcggttcg cccaatgttc tggcctctcg 421 attgtgggtg taaataaaaa atataaat