Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044395861             448 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123003405), mRNA.
ACCESSION   XM_044395861
VERSION     XM_044395861.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..448
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..448
                     /gene="LOC123003405"
                     /note="uncharacterized LOC123003405; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:123003405"
     CDS             128..433
                     /gene="LOC123003405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044251796.1"
                     /db_xref="GeneID:123003405"
                     /translation="MSQMLQLDALVMAMACLSTTQTDLGGGLMVPPSLENASSQSCPV
                     SSLSGLTTRMQSLSREIDSVKEQIGSLQEQLVDLRRTGSPPVVALGSPNVLASRLWV"
ORIGIN      
        1 tcgagtgacc tttgttttca ttcgcactag cattgtgcct ccgatcggta gttagtatct
       61 agttggttac ttagttagtt agtcacgcag ttagctagtc cagtggccag tgaaagagag
      121 taggaaaatg tcgcagatgc tccagctgga cgccttggtc atggccatgg cctgtctgtc
      181 caccacgcaa acagatctgg gcggaggtct gatggtgccg ccctccttgg aaaatgcgag
      241 ctcccagagt tgtcccgttt cgtccttgag tggcctgacc acccggatgc agtcgctgag
      301 cagggagata gacagtgtaa aggagcaaat cggaagtctg caggagcagc tggtggatct
      361 gcggagaacg ggaagtcccc cggtggtggc actcggttcg cccaatgttc tggcctctcg
      421 attgtgggtg taaataaaaa atataaat