Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii coiled-coil domain-containing


LOCUS       XM_044395710            1187 bp    mRNA    linear   INV 09-DEC-2024
            protein 137 (LOC108056732), mRNA.
ACCESSION   XM_044395710
VERSION     XM_044395710.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044395710.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1187
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1187
                     /gene="LOC108056732"
                     /note="coiled-coil domain-containing protein 137; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056732"
     CDS             82..1089
                     /gene="LOC108056732"
                     /codon_start=1
                     /product="coiled-coil domain-containing protein 137"
                     /protein_id="XP_044251645.1"
                     /db_xref="GeneID:108056732"
                     /translation="MARKRKIPVRKHHGIRDPLKQQEQKEKKLSKVTNNPPVKVDDQQ
                     VSFKFRQFQQLADATKTGKRLKLGQIGREDRPKSAPGGKKGATSSAGASKETRNIKQF
                     ANETDEDYLRRVNRITSASVREAHYEAKYGVNVIRNPKTGEITVQKRPKNEIDELLKQ
                     KQKEQRLAGKKGRRKTPIPQKSTMDAKTSRELVKRAYREAQQEVETEEKQNAGPTEYK
                     RDVVAFGEIVHAPPSIKVLPRKAEKSETVPRPGRKGNLLLKNMLDPEQNQSNQQEQDE
                     RSRLKVAAKSKGAFKTPTKAQMKGKRKDLPLATRSMLESERNKMVLLYRQLKNKTTAD
                     A"
ORIGIN      
        1 taccactacc acgagtttgg tttttctatt tggatttatt tattttattt tggaggaact
       61 tgaacgaaac acacacattt aatggcccga aagcgaaaga ttcccgtgcg caagcaccac
      121 ggcattcgcg accccctcaa gcagcaggag cagaaggaga aaaaactctc caaggtaacc
      181 aataacccac ctgttaaagt ggacgatcag caggtgtcct tcaagttccg gcagttccag
      241 cagctggccg atgccaccaa aacggggaag cggctgaaac tgggacaaat tggccgggag
      301 gatcggccca aatccgcgcc aggcggcaaa aagggagcta cttcctccgc cggcgcctcc
      361 aaggagacgc gtaacatcaa gcagttcgcc aacgaaacgg acgaggatta cctgcgtcgg
      421 gtgaaccgca taaccagcgc ctccgtccgc gaagcccact acgaggccaa gtacggcgta
      481 aatgtgatac ggaatcccaa aacaggcgag attacggtcc aaaagagacc caagaacgag
      541 attgacgagc tgctcaagca gaagcaaaag gagcaacgtt tggcgggcaa aaagggacgc
      601 cgaaagacgc caatcccgca gaaatccaca atggatgcga aaaccagcag ggagctggtg
      661 aaacgagcct atcgggaggc ccaacaggag gtcgaaacgg aggagaagca gaatgccggg
      721 cccacggaat acaagcgaga tgtggtggcc ttcggggaga ttgtccatgc gccgccttct
      781 attaaagtac tgccacgcaa ggcggagaaa agcgagacgg tgccgcgacc aggacgtaag
      841 ggcaatttgc tgctcaagaa catgctggat ccggagcaaa atcagtccaa tcagcaggag
      901 caggatgaaa gaagccggct taaagtggcc gccaagtcca agggcgcctt taaaacgccc
      961 accaaggcgc agatgaaggg caagcgcaag gatctgcccc tggccaccag atccatgctc
     1021 gagtccgagc gcaataagat ggtactactg taccgtcagc tcaaaaacaa aacgacagcg
     1081 gatgcctgaa gaattagact agatttcgaa gtttaaatct tatttttttt agtcctaaaa
     1141 accctgtact ttatcactaa tgttacacaa ttgcatttgt taattac