Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044395710 1187 bp mRNA linear INV 09-DEC-2024 protein 137 (LOC108056732), mRNA. ACCESSION XM_044395710 VERSION XM_044395710.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044395710.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1187 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1187 /gene="LOC108056732" /note="coiled-coil domain-containing protein 137; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056732" CDS 82..1089 /gene="LOC108056732" /codon_start=1 /product="coiled-coil domain-containing protein 137" /protein_id="XP_044251645.1" /db_xref="GeneID:108056732" /translation="MARKRKIPVRKHHGIRDPLKQQEQKEKKLSKVTNNPPVKVDDQQ VSFKFRQFQQLADATKTGKRLKLGQIGREDRPKSAPGGKKGATSSAGASKETRNIKQF ANETDEDYLRRVNRITSASVREAHYEAKYGVNVIRNPKTGEITVQKRPKNEIDELLKQ KQKEQRLAGKKGRRKTPIPQKSTMDAKTSRELVKRAYREAQQEVETEEKQNAGPTEYK RDVVAFGEIVHAPPSIKVLPRKAEKSETVPRPGRKGNLLLKNMLDPEQNQSNQQEQDE RSRLKVAAKSKGAFKTPTKAQMKGKRKDLPLATRSMLESERNKMVLLYRQLKNKTTAD A" ORIGIN 1 taccactacc acgagtttgg tttttctatt tggatttatt tattttattt tggaggaact 61 tgaacgaaac acacacattt aatggcccga aagcgaaaga ttcccgtgcg caagcaccac 121 ggcattcgcg accccctcaa gcagcaggag cagaaggaga aaaaactctc caaggtaacc 181 aataacccac ctgttaaagt ggacgatcag caggtgtcct tcaagttccg gcagttccag 241 cagctggccg atgccaccaa aacggggaag cggctgaaac tgggacaaat tggccgggag 301 gatcggccca aatccgcgcc aggcggcaaa aagggagcta cttcctccgc cggcgcctcc 361 aaggagacgc gtaacatcaa gcagttcgcc aacgaaacgg acgaggatta cctgcgtcgg 421 gtgaaccgca taaccagcgc ctccgtccgc gaagcccact acgaggccaa gtacggcgta 481 aatgtgatac ggaatcccaa aacaggcgag attacggtcc aaaagagacc caagaacgag 541 attgacgagc tgctcaagca gaagcaaaag gagcaacgtt tggcgggcaa aaagggacgc 601 cgaaagacgc caatcccgca gaaatccaca atggatgcga aaaccagcag ggagctggtg 661 aaacgagcct atcgggaggc ccaacaggag gtcgaaacgg aggagaagca gaatgccggg 721 cccacggaat acaagcgaga tgtggtggcc ttcggggaga ttgtccatgc gccgccttct 781 attaaagtac tgccacgcaa ggcggagaaa agcgagacgg tgccgcgacc aggacgtaag 841 ggcaatttgc tgctcaagaa catgctggat ccggagcaaa atcagtccaa tcagcaggag 901 caggatgaaa gaagccggct taaagtggcc gccaagtcca agggcgcctt taaaacgccc 961 accaaggcgc agatgaaggg caagcgcaag gatctgcccc tggccaccag atccatgctc 1021 gagtccgagc gcaataagat ggtactactg taccgtcagc tcaaaaacaa aacgacagcg 1081 gatgcctgaa gaattagact agatttcgaa gtttaaatct tatttttttt agtcctaaaa 1141 accctgtact ttatcactaa tgttacacaa ttgcatttgt taattac