PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_044395135             993 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056011), mRNA.
ACCESSION   XM_044395135
VERSION     XM_044395135.1
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 29% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..993
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..993
                     /gene="LOC108056011"
                     /note="uncharacterized LOC108056011; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108056011"
     CDS             1..993
                     /gene="LOC108056011"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044251070.1"
                     /db_xref="GeneID:108056011"
                     /translation="MLRYWLLLLFLAFLLIGDLSALRDLQDPHQVLSQDSSGSREKRG
                     TVTLDFGLLLRNLLLKSAQLSSAKANLVRTTRRPPMTTTTTPPPPPPPPPPQRSRRPI
                     WHPFFSSGFLPLDYDYADPPAAGPPAPPPPPPPPQPTRRPVRPPVRPRPRPPTTTAPP
                     PPPPPPNYDYDYDYDAPPAAPTAAPPPPPPPPAPRPRPRPRPRPPQPQQLGDRLIYQY
                     AQPTDTFFRSRSAEEAAAAQPDDTDTGANADLDTDAGAPPPDPPAPTGPRFLVNYESD
                     SDFGQQVQDQEQEPPAGSARPSPSSQGYFQQLDFGSLGNLNRFPTPNQQQYFYN"
ORIGIN      
        1 atgttacgat attggctcct cctcctcttc ctggccttcc tgctaatagg agatctctcg
       61 gctctccgag atctgcagga tccccatcag gtccttagcc aggactccag tggatcacgg
      121 gagaagcgcg gcacagtcac cctggacttt ggcctcctcc ttcgcaatct gctcttgaag
      181 agcgcccagt tgtcctcggc caaggccaat ctggtgcgga ccactcgtcg tcctccaatg
      241 acgacaacga ccacgcctcc tccgcctccg ccgccgcctc ctccgcagcg cagtcgtcga
      301 cccatttggc atccgttctt cagttccggc tttctgcctt tggactatga ctacgctgat
      361 cctccagcgg caggacctcc ggctcctccg ccaccaccac ctcctccgca accaactaga
      421 aggccagttc gaccgccagt aagaccacgt cctcgtcctc cgacgacgac ggctcctcca
      481 ccgccaccgc ctccgccgaa ctatgactac gactatgact acgatgctcc gccagctgcg
      541 cccacagcgg caccaccgcc tcctcctccg cctcctgctc cccgcccaag gccacgccca
      601 cgcccccgcc caccgcagcc acaacagctg ggggatcggc taatctatca gtacgcacaa
      661 cctactgata ccttctttag gtcgcgttcc gcggaggagg cggcggcagc acaaccggat
      721 gatacagata ctggtgctaa tgcagattta gatacggatg ctggagcccc accccccgat
      781 ccccccgctc caactggccc ccggtttttg gtcaactacg agagcgacag cgactttggg
      841 cagcaggttc aggatcagga acaggaaccg cctgcaggat cagctagacc atcaccatca
      901 tcccaaggct atttccagca actcgacttt ggcagcctcg gcaatctcaa tcgcttcccg
      961 actcccaatc agcagcagta cttctacaac taa