Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein THEM6 (LOC108065508),


LOCUS       XM_044395100            1484 bp    mRNA    linear   INV 09-DEC-2024
            transcript variant X2, mRNA.
ACCESSION   XM_044395100
VERSION     XM_044395100.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044395100.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1484
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1484
                     /gene="LOC108065508"
                     /note="protein THEM6; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108065508"
     CDS             387..1181
                     /gene="LOC108065508"
                     /codon_start=1
                     /product="protein THEM6"
                     /protein_id="XP_044251035.1"
                     /db_xref="GeneID:108065508"
                     /translation="MEQLCYLALCVLLAIVVLYGLLELHYFLRMCLCVLLARFVKRRC
                     HILDATTVNGLCLTNDVDTLLYHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVF
                     QGAATIRYRRFIRPFHRFNIVSRIIYWDEQSLFMEHRFVRPSDKFVHCIAICRQRVID
                     VSMEAVMAELLPRTSSNGFRATASPSLAAPTTAASATSAAGGISNPAMDTSLAENGHG
                     TTSGGSATPTAAAAAHCLKLKPSLPPELSKWIEYNDMSSKNLRSGC"
     misc_feature    552..872
                     /gene="LOC108065508"
                     /note="Thioesterase-like superfamily; Region: 4HBT_2;
                     pfam13279"
                     /db_xref="CDD:463826"
ORIGIN      
        1 tttgctgtgt gcgtgagtgt ttgactaaga atcaggtgat ggtgaaaaca tgacctaatt
       61 ccgctcagca tcttggacat tttagccagg aacagaacca aaaatcgcgc ttagaaaacc
      121 acccccgtaa ccttaacccc ccgaacgccg aaagtctcac ccttaaccct taaccgaagc
      181 actttggtgg cttcctgttt ccgcattcta attagattgc catcacttga caatttgatt
      241 gccagccgtc ttgatgaact gttcctcatc ctcctccttc ttcttcttct ctttccgccc
      301 ctcgaattgc agcgccaccc gttccaccgc tccaccacca cgccccctaa gcgaacccca
      361 agcgctgccc atctgccagc agcggaatgg agcagctgtg ctacctggcg ctgtgcgtcc
      421 tgctggccat cgtcgtgctc tacgggctcc tggagctcca ctacttcctg cgcatgtgcc
      481 tctgcgtgct gctggcgcgg tttgtgaaga ggcgctgcca catcctggac gccaccacgg
      541 tcaacggact ctgcctcacc aacgatgtgg acaccttgtt gtaccacatg aacaacgctc
      601 gttacttccg tgagctggac tttgcccgcg tggacttcta cgagcggacc aatctgtacc
      661 gcaccatcac gggaatgggc ggttccgtgt tccagggggc ggccaccatt cgctaccgcc
      721 gcttcatccg ccccttccac cggtttaaca ttgtgtcgcg gataatttac tgggacgagc
      781 agtcgctgtt catggagcat cgattcgtgc gtccttcgga caagtttgtc cactgcatcg
      841 ccatctgccg ccagcgggtg atcgacgtgt ccatggaggc ggtgatggcc gaacttctgc
      901 ccaggacctc ctccaacgga ttccgggcga cggcgtcgcc ttcgctggct gctcccacga
      961 cggcggcttc agcgacgtcg gcggctggcg gcattagcaa tccggcgatg gacacttcgc
     1021 tggcggagaa tggacatggg acgacgagcg gaggcagtgc cacgcccacc gcggcggcag
     1081 cggcgcactg cctcaagctg aagccctcgc tgccgccgga gctgtccaag tggatcgagt
     1141 acaacgatat gtccagcaag aatctgcgca gcggctgctg actggagtcg ttggaatcgc
     1201 cagcggaagc gcatgcgcaa ccggaaacgg aaacggatac tctaatatta acccactttt
     1261 tttttgtttt tgtctcgcgt gcttgtgcgt gtgtgtgtgc gtgctaatgt gtgtgctaat
     1321 gtttaatgtc taagtgtgcc cgtggaatgt gtaaattgta agctatgtaa gtgtctgtaa
     1381 aacaaaacaa caacaaaaaa cacccgccct cttttggcct taactacttg tattgtataa
     1441 ttacctagag atcaaccacg ccccctagaa acaaaaaaat acga