Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii sepiapterin reductase


LOCUS       XM_044394756            1197 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123003144), mRNA.
ACCESSION   XM_044394756
VERSION     XM_044394756.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044394756.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1197
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1197
                     /gene="LOC123003144"
                     /note="sepiapterin reductase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:123003144"
     CDS             198..1019
                     /gene="LOC123003144"
                     /codon_start=1
                     /product="sepiapterin reductase"
                     /protein_id="XP_044250691.1"
                     /db_xref="GeneID:123003144"
                     /translation="MAAKRMDLNRRTFLVLSGSSNPLGQSLALEFCRRLASGSVALIL
                     DEDQEQLRKLENQLQNELKSENVRVTTGQLDKSQSNGVQLMEQALKDHFGGQQADQRF
                     ERSIILHNEGQAATHVLLEPQSTGDWKAYVQQQLYAPVALNQMWLQSKYLEKVEKLAV
                     NVTSSLMVRPLVHSGLLCSCKRARDMYFRAMAAEEHRFGVHVLSFSPGLMATHESQCD
                     VNGNRINPGELVASKQLLQLPRIQPHQATLKLINILEEISFVSGHDVDYYDTFVL"
     misc_feature    234..1004
                     /gene="LOC123003144"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(249..251,255..260,264..266,330..338,525..533,
                     681..689,726..728,738..740,816..827)
                     /gene="LOC123003144"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(600..602,687..689,726..728,738..740)
                     /gene="LOC123003144"
                     /note="active site"
                     /db_xref="CDD:187535"
     polyA_site      1197
                     /gene="LOC123003144"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcggaacccc agttgcccag ccgagtatat atgtatactt ggcccatcgg aatctagctt
       61 atcagtcgtt cgaaaccaag tccagctggc aaggtccgct gaaaattcgg caatagtaca
      121 gtcgtacgcc tccaagtgat cgcaagtgga aagttcctca gttctaaata tccctaagga
      181 gccttaaagt cgaaataatg gcagcaaaga gaatggattt aaatagacgc acctttttgg
      241 tgctcagcgg cagctcgaat cccctgggtc aatccctggc cctggagttc tgccggcgcc
      301 tggcctcggg atccgtggcc ctgatcctgg acgaagatca ggagcagctg cgcaagctgg
      361 agaatcaact ccagaacgag ctgaagtcgg agaacgtacg ggtgacgact ggccagctgg
      421 acaagagtca atcgaacgga gtgcagctaa tggagcaggc tctgaaggac catttcggag
      481 gtcagcaggc cgaccaacga ttcgagcgtt cgataatcct gcacaacgag ggccaggcgg
      541 ccacccatgt gctcctggag ccccagagca ccggcgactg gaaggcctat gtccagcagc
      601 aactgtacgc cccggtggcc ctcaatcaga tgtggctgca gtccaagtat ctggagaagg
      661 tggagaagct ggccgtgaat gtgacctcct ccctgatggt ccgtcctctg gtccactctg
      721 gactcctgtg ctcctgcaag cgggccaggg acatgtactt ccgggccatg gccgccgagg
      781 agcatcgctt cggtgtccac gtcctcagct tttcgcccgg tctgatggcc acccacgaga
      841 gccagtgcga tgtgaacggc aaccggatca atcccggcga actcgtggcc tcgaagcagc
      901 tgctccagct gcccaggatc cagccgcacc aggccacgct caagctgatc aacatcctgg
      961 aggagatctc cttcgtttcc ggtcacgatg tcgactacta cgacaccttc gttttatgag
     1021 tagcaccgtg gcggtgggct gcgtccccga tggactcggt tctgagtttg gctgacgatt
     1081 cggatgctgt ttttgatttg atcgccttgg aaatgaataa aatctggcca atgaccctga
     1141 atttaaacct gaaagtgcaa gaaaacccag cacatgaaca ggaaaacgaa aaacaaa