Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044394756 1197 bp mRNA linear INV 09-DEC-2024 (LOC123003144), mRNA. ACCESSION XM_044394756 VERSION XM_044394756.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044394756.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1197 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1197 /gene="LOC123003144" /note="sepiapterin reductase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:123003144" CDS 198..1019 /gene="LOC123003144" /codon_start=1 /product="sepiapterin reductase" /protein_id="XP_044250691.1" /db_xref="GeneID:123003144" /translation="MAAKRMDLNRRTFLVLSGSSNPLGQSLALEFCRRLASGSVALIL DEDQEQLRKLENQLQNELKSENVRVTTGQLDKSQSNGVQLMEQALKDHFGGQQADQRF ERSIILHNEGQAATHVLLEPQSTGDWKAYVQQQLYAPVALNQMWLQSKYLEKVEKLAV NVTSSLMVRPLVHSGLLCSCKRARDMYFRAMAAEEHRFGVHVLSFSPGLMATHESQCD VNGNRINPGELVASKQLLQLPRIQPHQATLKLINILEEISFVSGHDVDYYDTFVL" misc_feature 234..1004 /gene="LOC123003144" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(249..251,255..260,264..266,330..338,525..533, 681..689,726..728,738..740,816..827) /gene="LOC123003144" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(600..602,687..689,726..728,738..740) /gene="LOC123003144" /note="active site" /db_xref="CDD:187535" polyA_site 1197 /gene="LOC123003144" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcggaacccc agttgcccag ccgagtatat atgtatactt ggcccatcgg aatctagctt 61 atcagtcgtt cgaaaccaag tccagctggc aaggtccgct gaaaattcgg caatagtaca 121 gtcgtacgcc tccaagtgat cgcaagtgga aagttcctca gttctaaata tccctaagga 181 gccttaaagt cgaaataatg gcagcaaaga gaatggattt aaatagacgc acctttttgg 241 tgctcagcgg cagctcgaat cccctgggtc aatccctggc cctggagttc tgccggcgcc 301 tggcctcggg atccgtggcc ctgatcctgg acgaagatca ggagcagctg cgcaagctgg 361 agaatcaact ccagaacgag ctgaagtcgg agaacgtacg ggtgacgact ggccagctgg 421 acaagagtca atcgaacgga gtgcagctaa tggagcaggc tctgaaggac catttcggag 481 gtcagcaggc cgaccaacga ttcgagcgtt cgataatcct gcacaacgag ggccaggcgg 541 ccacccatgt gctcctggag ccccagagca ccggcgactg gaaggcctat gtccagcagc 601 aactgtacgc cccggtggcc ctcaatcaga tgtggctgca gtccaagtat ctggagaagg 661 tggagaagct ggccgtgaat gtgacctcct ccctgatggt ccgtcctctg gtccactctg 721 gactcctgtg ctcctgcaag cgggccaggg acatgtactt ccgggccatg gccgccgagg 781 agcatcgctt cggtgtccac gtcctcagct tttcgcccgg tctgatggcc acccacgaga 841 gccagtgcga tgtgaacggc aaccggatca atcccggcga actcgtggcc tcgaagcagc 901 tgctccagct gcccaggatc cagccgcacc aggccacgct caagctgatc aacatcctgg 961 aggagatctc cttcgtttcc ggtcacgatg tcgactacta cgacaccttc gttttatgag 1021 tagcaccgtg gcggtgggct gcgtccccga tggactcggt tctgagtttg gctgacgatt 1081 cggatgctgt ttttgatttg atcgccttgg aaatgaataa aatctggcca atgaccctga 1141 atttaaacct gaaagtgcaa gaaaacccag cacatgaaca ggaaaacgaa aaacaaa