Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044394719 867 bp mRNA linear INV 09-DEC-2024 (LOC108068115), mRNA. ACCESSION XM_044394719 VERSION XM_044394719.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044394719.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..867 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..867 /gene="LOC108068115" /note="uncharacterized LOC108068115; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108068115" CDS 114..722 /gene="LOC108068115" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_044250654.1" /db_xref="GeneID:108068115" /translation="MASKKLVKPKKQDEKNICPIDYKNEKPGPSVNCKLQGESSSSKM AAKKLDKPKKRDEKRNELICPIEYKNEMPGPAIDCKFMPCGKDILEYTEQPISFPHLE FAFLQNIGLQTLMGLDSLDLSAFDGPMDPEEEADLEAQAIRNKEQMDPETAALIADID AAIARYSKRPDVGQEASPGASTSRGAKASGAGTSSSKKPEKK" ORIGIN 1 actgcatcgc ctgtcaaagc gactgactaa gcacgaatca gaaaacttgt cgagcaattc 61 ggacgagaga ccagaaacga ggcgaaaatc aagacgaaag cagctctccc ataatggcgt 121 caaaaaaatt ggttaaaccg aagaagcagg atgaaaaaaa catctgcccc attgactaca 181 aaaatgagaa gcccggacct tcggtaaatt gcaaattgca aggggaaagc agctcttcca 241 aaatggcggc aaagaaattg gacaaaccga agaagcggga tgaaaagcgc aatgagttaa 301 tctgccccat tgagtacaaa aatgagatgc ccggacctgc gatagattgc aaatttatgc 361 cctgcggcaa ggatattctg gagtacactg agcagcccat ttcgtttccc cacctggagt 421 ttgccttttt gcagaatata ggacttcaaa cgctcatggg cttggattcg ttggatctga 481 gcgcttttga tggaccaatg gatcccgagg aggaagcaga cttagaggct caggcaatcc 541 gcaataagga gcaaatggat cccgaaactg cagctcttat tgccgatata gacgctgcga 601 ttgctcgtta cagtaagcgc ccagatgttg gccaagaagc gtccccaggc gcctcaacct 661 cgcgtggggc taaggcgtcc ggtgcaggaa cttccagttc caaaaagcct gaaaaaaaat 721 agcctgcaac agcaaataga gttgactggc agaaccttcg aggagataag gaaacccttt 781 atttgacatt ccatcaatca tcatcaattc atcagctgaa aagaacaaaa aaaaatgttg 841 attaaaactc acaaataaac gaattat