Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044394719             867 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068115), mRNA.
ACCESSION   XM_044394719
VERSION     XM_044394719.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044394719.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..867
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..867
                     /gene="LOC108068115"
                     /note="uncharacterized LOC108068115; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108068115"
     CDS             114..722
                     /gene="LOC108068115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044250654.1"
                     /db_xref="GeneID:108068115"
                     /translation="MASKKLVKPKKQDEKNICPIDYKNEKPGPSVNCKLQGESSSSKM
                     AAKKLDKPKKRDEKRNELICPIEYKNEMPGPAIDCKFMPCGKDILEYTEQPISFPHLE
                     FAFLQNIGLQTLMGLDSLDLSAFDGPMDPEEEADLEAQAIRNKEQMDPETAALIADID
                     AAIARYSKRPDVGQEASPGASTSRGAKASGAGTSSSKKPEKK"
ORIGIN      
        1 actgcatcgc ctgtcaaagc gactgactaa gcacgaatca gaaaacttgt cgagcaattc
       61 ggacgagaga ccagaaacga ggcgaaaatc aagacgaaag cagctctccc ataatggcgt
      121 caaaaaaatt ggttaaaccg aagaagcagg atgaaaaaaa catctgcccc attgactaca
      181 aaaatgagaa gcccggacct tcggtaaatt gcaaattgca aggggaaagc agctcttcca
      241 aaatggcggc aaagaaattg gacaaaccga agaagcggga tgaaaagcgc aatgagttaa
      301 tctgccccat tgagtacaaa aatgagatgc ccggacctgc gatagattgc aaatttatgc
      361 cctgcggcaa ggatattctg gagtacactg agcagcccat ttcgtttccc cacctggagt
      421 ttgccttttt gcagaatata ggacttcaaa cgctcatggg cttggattcg ttggatctga
      481 gcgcttttga tggaccaatg gatcccgagg aggaagcaga cttagaggct caggcaatcc
      541 gcaataagga gcaaatggat cccgaaactg cagctcttat tgccgatata gacgctgcga
      601 ttgctcgtta cagtaagcgc ccagatgttg gccaagaagc gtccccaggc gcctcaacct
      661 cgcgtggggc taaggcgtcc ggtgcaggaa cttccagttc caaaaagcct gaaaaaaaat
      721 agcctgcaac agcaaataga gttgactggc agaaccttcg aggagataag gaaacccttt
      781 atttgacatt ccatcaatca tcatcaattc atcagctgaa aagaacaaaa aaaaatgttg
      841 attaaaactc acaaataaac gaattat