PREDICTED: Drosophila takahashii box C/D snoRNA protein 1

LOCUS       XM_044394682            1325 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108062974), mRNA.
ACCESSION   XM_044394682
VERSION     XM_044394682.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044394682.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1325
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1325
                     /gene="LOC108062974"
                     /note="box C/D snoRNA protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108062974"
     CDS             117..1145
                     /gene="LOC108062974"
                     /codon_start=1
                     /product="box C/D snoRNA protein 1"
                     /protein_id="XP_044250617.2"
                     /db_xref="GeneID:108062974"
                     /translation="MMAAETETSTKTSTLRLGMCEVCAAKEARYACPKCEVKTCSLPC
                     VQIHKRELSCDGQRDRTKFVPLSEMTAREFMSDYCFLEECTRYAENRKTDQCKRFTHD
                     QRNLPVAQHRMRTAARRRNIDLRLQLENFSRHKENTTYLNWKLGRFYWRVEWLFANIP
                     LEANHSRDVARFVDDRCDEELVLSDLILKYVDLQHETARDQRKLLANHQTAGIGQLSF
                     WLRAEGVRRSSTRCHHLEAAKTLAENLAGRTIVEFPTIFVTYESKPPGGYEVIDSSDE
                     LQEEEEEEEQPATKTNPSSDATPTALDLDEPHDVYHDLAAAFVGEDVSEAEDDDEFEA
                     LYREHVEL"
     misc_feature    168..287
                     /gene="LOC108062974"
                     /note="zinc finger HIT (zf-HIT) found in Box C/D snoRNA
                     protein 1 (BCD1) and similar proteins; Region:
                     zf-HIT_BCD1; cd23023"
                     /db_xref="CDD:467795"
     misc_feature    order(174..176,183..185,210..212,219..221,234..236,
                     246..248,258..260,276..278)
                     /gene="LOC108062974"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:467795"
     polyA_site      1325
                     /gene="LOC108062974"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcctacgatc tagctatttc ttagccgcac cttggaaatc accagatcgt cagcactttc
       61 gaatgtaaac aatggcaaca cgcggcttca gtttgaatgg gaaacgtaaa acatagatga
      121 tggccgcgga aaccgaaacg agcactaaaa ccagcaccct ccggctggga atgtgcgagg
      181 tgtgcgccgc caaggaggcc cgctacgcgt gtcccaagtg cgaggtgaag acctgcagcc
      241 tgccctgcgt ccagatccac aagagggagc tcagctgcga tggccagcgg gatcgcacca
      301 agttcgtgcc cctcagcgag atgacggcgc gggagttcat gagcgactac tgcttcttgg
      361 aggagtgcac ccgctatgcg gagaaccgca agaccgatca gtgcaagcgg ttcacccacg
      421 accagaggaa tctcccggtg gcccagcacc ggatgcgaac ggcggccagg aggcgcaaca
      481 tcgacctgcg actgcaactg gagaacttca gccggcacaa ggagaacacc acgtacctca
      541 actggaagct gggacgtttc tattggcgcg tcgagtggct ttttgcaaac attccgctcg
      601 aggcgaacca ctcccgcgat gtggcccgat ttgtggacga ccggtgtgac gaggagcttg
      661 tcctgtccga tctgatcctc aagtatgtgg atctgcagca cgaaacggcg cgggatcagc
      721 gcaaactgct ggccaaccat cagactgccg gcattggcca gctcagcttt tggctgcgcg
      781 ccgagggcgt gcgtcgcagt tccacgagat gccatcacct ggaggcggcc aaaacgctgg
      841 ccgagaatct agccggcagg accatcgtgg agtttcccac tatctttgtt acatacgaat
      901 cgaagccccc aggcggttat gaagtcatcg acagcagtga cgaactgcag gaggaggagg
      961 aggaggagga gcagcctgca accaaaacaa acccatcttc cgatgcaaca cccactgcat
     1021 tggatttaga tgagccacac gatgtctacc atgatctggc tgcagctttt gttggcgaag
     1081 atgtcagtga agctgaggac gacgatgaat tcgaggcact ctacagagaa cacgtggagc
     1141 tgtagagacg aaccagcaga tgtacaatag acctgtccaa atttgggtca caatgccacc
     1201 ccgtaaccac tgataattaa gtaaataaaa caattatctt ttatattttt acataaatgt
     1261 tgtattttct cgtacgcatt tgatttaatt tgtattttag gctaattaaa cataaagaat
     1321 tcata