Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Molybdenum cofactor synthesis


LOCUS       XM_044394063            2142 bp    mRNA    linear   INV 09-DEC-2024
            protein cinnamon (cin), mRNA.
ACCESSION   XM_044394063
VERSION     XM_044394063.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044394063.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2142
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2142
                     /gene="cin"
                     /note="Molybdenum cofactor synthesis protein cinnamon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 6 Proteins"
                     /db_xref="GeneID:108056237"
     CDS             123..1934
                     /gene="cin"
                     /codon_start=1
                     /product="molybdenum cofactor synthesis protein cinnamon"
                     /protein_id="XP_044249998.1"
                     /db_xref="GeneID:108056237"
                     /translation="MESITFGVLTISDTCCKEPAKDKSGPCLKQLIGESFANAQVIGS
                     IVPDEKDLIQAELRKWINQEDLRVILTTGGTGFAPRDVTPEATKPLLEKECPQLALLI
                     TLDSLKKTQFAALSRGLCGIAGNTLILNFPGSEKAVKECFATVRDLLPHALHLIGDQV
                     SLVRQTHAEVQGLAFPTSNHICPHKTGAGSDSDRNSPFPMQPVHEVLSIIFETVQRTS
                     ELDRILWQLNSPVNIPPFRASIKDGYAMKSTGFSGSKRVLGCIAAGDELNSSPLAEDE
                     CFKINTGAPLPLEADCVVQVEDTRLLQRDKHGQESLVDIMVEPQAGLDVRPVGHDLST
                     RDRIFPAADPSSVVVKSLLASVGHRLAVPKPRVAIVSTGSELLSPRDQPTPGKIFDSN
                     TTMLAELLLYFGFDCLHTSVLSDSFAQTRESLSDLFEVVDFVICSGGVSMGDKDFVKP
                     VLEDLQFKLHCGRVNMKPGKPMTFASRNEKYFFGLPGNPVSAFVTFHLFALPAIRWAA
                     GWDRQKCSLPVINVKLLNDLSLDGRPEFVRASVISKSGELYASINGDQISSRLQSIVG
                     ADVLVNLPARTSDRPTAKAGEVFPASVLRYDFISKYE"
     misc_feature    132..590
                     /gene="cin"
                     /note="MogA_MoaB family. Members of this family are
                     involved in biosynthesis of the molybdenum cofactor (MoCF)
                     an essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea; Region: MogA_MoaB;
                     cd00886"
                     /db_xref="CDD:238451"
     misc_feature    order(342..350,438..440,516..521,531..533,540..542)
                     /gene="cin"
                     /note="MPT binding site [active]"
                     /db_xref="CDD:238451"
     misc_feature    order(348..350,354..359,363..365,375..377,399..407,
                     420..422,429..434,462..464,471..473,588..590)
                     /gene="cin"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238451"
     misc_feature    756..1904
                     /gene="cin"
                     /note="MoeA family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (MoCF), an
                     essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoeA;
                     cd00887"
                     /db_xref="CDD:238452"
     misc_feature    order(771..773,1113..1115,1149..1160,1173..1175,
                     1182..1187,1191..1193,1287..1289,1293..1295,1302..1304,
                     1680..1682,1797..1799,1890..1892)
                     /gene="cin"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238452"
     misc_feature    order(1236..1241,1245..1247,1365..1367,1437..1439)
                     /gene="cin"
                     /note="putative functional site [active]"
                     /db_xref="CDD:238452"
     misc_feature    order(1437..1445,1578..1583,1593..1595,1602..1604)
                     /gene="cin"
                     /note="putative MPT binding site [active]"
                     /db_xref="CDD:238452"
     polyA_site      2142
                     /gene="cin"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatcgattac cgatagtctc cacctgcaag cggaaagttt gcgtgctaat ttgatgtatt
       61 gtatttaaca atttaattgg gattcgtgag tgggagcaac cagaaccgct gcacatgacg
      121 taatggagtc gattaccttt ggagttctga ccattagtga cacctgttgc aaggagccgg
      181 caaaggataa aagtggtccc tgcttaaaac aactgattgg tgaatccttt gccaatgccc
      241 aggtgattgg gagcattgtg cccgacgaga aggacttaat tcaggcggag ttgcggaagt
      301 ggatcaacca ggaggatctc cgggtgatcc tgaccacggg cggaacagga tttgcgccaa
      361 gggatgtgac tccggaggcc actaaacctc tgctggaaaa ggagtgcccg caactggcgc
      421 tgctcatcac cctggactcc ctgaagaaga cccaatttgc cgccctttcc cgcggcctct
      481 gtggcatcgc ggggaacacc ctgatcctca actttcccgg cagcgaaaag gctgtaaaag
      541 agtgctttgc gacggtgagg gatctcctgc cccacgccct ccatctcatc ggtgaccagg
      601 tgtcgctggt gcggcagaca catgcggagg ttcagggatt agcttttcct accagcaatc
      661 acatttgccc ccataaaacg ggcgcaggca gcgattcgga tcgcaattca ccctttccca
      721 tgcagcccgt ccacgaggtg ctctcgatta tcttcgaaac ggtgcagaga accagcgagt
      781 tggacaggat cctctggcag ctcaactcgc cggtgaatat tccgcccttt agggcttcta
      841 tcaaggatgg ctacgccatg aagtccaccg gcttctcggg cagcaagcga gttctgggct
      901 gcatagccgc cggcgatgag ctcaattctt cgcctctagc tgaggatgag tgctttaaaa
      961 taaacactgg agcaccgctg ccgctggagg cggactgtgt ggtccaggtg gaggacacca
     1021 ggctgctgca gcgggacaag cacggccagg agagcctggt agacataatg gtggagccgc
     1081 aggccggctt ggatgtgcga cctgtgggtc acgatctaag cacccgggat cgcatctttc
     1141 ccgccgcgga tccctcctct gtggtggtca aatccctgct ggcctccgtg ggccatcggc
     1201 tggccgtgcc caagccccgc gtggccattg tgtccacggg cagtgagcta ctctcgccgc
     1261 gcgatcaacc gacgccgggc aagatcttcg actcgaatac caccatgctg gcggaactgc
     1321 tgctctactt tggcttcgac tgcctgcaca cgagtgtgct gagcgacagc ttcgcgcaga
     1381 cccgggaatc cctttccgat ctcttcgagg tggtggactt tgtcatctgc agcggcggcg
     1441 tgtcgatggg cgacaaggat ttcgtgaagc ccgtgctgga ggacctgcag ttcaagcttc
     1501 actgcggccg ggtgaacatg aagccaggca aacccatgac ctttgccagc cgcaacgaga
     1561 agtacttctt cgggctgccc ggcaatcccg tgtccgcctt cgtcaccttc cacctgttcg
     1621 ccctgcccgc catccgctgg gcggctggct gggatcgcca gaagtgctcc ctgcccgtga
     1681 tcaatgtgaa gttgctcaac gacctcagtt tggatggccg tccggaattc gttcgcgcct
     1741 cggtgatttc caaatccgga gagctgtacg ccagcattaa tggcgaccag ataagcagcc
     1801 gcctgcagag cattgtgggt gccgatgttt tggtcaacct gccggcaaga acctccgatc
     1861 gtccaactgc aaaggctggt gaagttttcc ccgcctccgt gctgcgctac gactttatct
     1921 ccaagtacga ataggaactg cccagacaaa ccaatccaga accaatcgaa tccagacatc
     1981 agacaacaca atagattagc acaaagattt attttttcat atatcgcaac attacgtaca
     2041 atgtccatca atcaacaccc ttagcagtgt gtaaaaaaac gagtataaag taaatattat
     2101 agaggccttc ctaaaggaag caatattatc gaacaaaaat aa