Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044394063 2142 bp mRNA linear INV 09-DEC-2024 protein cinnamon (cin), mRNA. ACCESSION XM_044394063 VERSION XM_044394063.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044394063.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2142 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..2142 /gene="cin" /note="Molybdenum cofactor synthesis protein cinnamon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:108056237" CDS 123..1934 /gene="cin" /codon_start=1 /product="molybdenum cofactor synthesis protein cinnamon" /protein_id="XP_044249998.1" /db_xref="GeneID:108056237" /translation="MESITFGVLTISDTCCKEPAKDKSGPCLKQLIGESFANAQVIGS IVPDEKDLIQAELRKWINQEDLRVILTTGGTGFAPRDVTPEATKPLLEKECPQLALLI TLDSLKKTQFAALSRGLCGIAGNTLILNFPGSEKAVKECFATVRDLLPHALHLIGDQV SLVRQTHAEVQGLAFPTSNHICPHKTGAGSDSDRNSPFPMQPVHEVLSIIFETVQRTS ELDRILWQLNSPVNIPPFRASIKDGYAMKSTGFSGSKRVLGCIAAGDELNSSPLAEDE CFKINTGAPLPLEADCVVQVEDTRLLQRDKHGQESLVDIMVEPQAGLDVRPVGHDLST RDRIFPAADPSSVVVKSLLASVGHRLAVPKPRVAIVSTGSELLSPRDQPTPGKIFDSN TTMLAELLLYFGFDCLHTSVLSDSFAQTRESLSDLFEVVDFVICSGGVSMGDKDFVKP VLEDLQFKLHCGRVNMKPGKPMTFASRNEKYFFGLPGNPVSAFVTFHLFALPAIRWAA GWDRQKCSLPVINVKLLNDLSLDGRPEFVRASVISKSGELYASINGDQISSRLQSIVG ADVLVNLPARTSDRPTAKAGEVFPASVLRYDFISKYE" misc_feature 132..590 /gene="cin" /note="MogA_MoaB family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF) an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea; Region: MogA_MoaB; cd00886" /db_xref="CDD:238451" misc_feature order(342..350,438..440,516..521,531..533,540..542) /gene="cin" /note="MPT binding site [active]" /db_xref="CDD:238451" misc_feature order(348..350,354..359,363..365,375..377,399..407, 420..422,429..434,462..464,471..473,588..590) /gene="cin" /note="trimer interface [polypeptide binding]; other site" /db_xref="CDD:238451" misc_feature 756..1904 /gene="cin" /note="MoeA family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF), an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and...; Region: MoeA; cd00887" /db_xref="CDD:238452" misc_feature order(771..773,1113..1115,1149..1160,1173..1175, 1182..1187,1191..1193,1287..1289,1293..1295,1302..1304, 1680..1682,1797..1799,1890..1892) /gene="cin" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:238452" misc_feature order(1236..1241,1245..1247,1365..1367,1437..1439) /gene="cin" /note="putative functional site [active]" /db_xref="CDD:238452" misc_feature order(1437..1445,1578..1583,1593..1595,1602..1604) /gene="cin" /note="putative MPT binding site [active]" /db_xref="CDD:238452" polyA_site 2142 /gene="cin" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatcgattac cgatagtctc cacctgcaag cggaaagttt gcgtgctaat ttgatgtatt 61 gtatttaaca atttaattgg gattcgtgag tgggagcaac cagaaccgct gcacatgacg 121 taatggagtc gattaccttt ggagttctga ccattagtga cacctgttgc aaggagccgg 181 caaaggataa aagtggtccc tgcttaaaac aactgattgg tgaatccttt gccaatgccc 241 aggtgattgg gagcattgtg cccgacgaga aggacttaat tcaggcggag ttgcggaagt 301 ggatcaacca ggaggatctc cgggtgatcc tgaccacggg cggaacagga tttgcgccaa 361 gggatgtgac tccggaggcc actaaacctc tgctggaaaa ggagtgcccg caactggcgc 421 tgctcatcac cctggactcc ctgaagaaga cccaatttgc cgccctttcc cgcggcctct 481 gtggcatcgc ggggaacacc ctgatcctca actttcccgg cagcgaaaag gctgtaaaag 541 agtgctttgc gacggtgagg gatctcctgc cccacgccct ccatctcatc ggtgaccagg 601 tgtcgctggt gcggcagaca catgcggagg ttcagggatt agcttttcct accagcaatc 661 acatttgccc ccataaaacg ggcgcaggca gcgattcgga tcgcaattca ccctttccca 721 tgcagcccgt ccacgaggtg ctctcgatta tcttcgaaac ggtgcagaga accagcgagt 781 tggacaggat cctctggcag ctcaactcgc cggtgaatat tccgcccttt agggcttcta 841 tcaaggatgg ctacgccatg aagtccaccg gcttctcggg cagcaagcga gttctgggct 901 gcatagccgc cggcgatgag ctcaattctt cgcctctagc tgaggatgag tgctttaaaa 961 taaacactgg agcaccgctg ccgctggagg cggactgtgt ggtccaggtg gaggacacca 1021 ggctgctgca gcgggacaag cacggccagg agagcctggt agacataatg gtggagccgc 1081 aggccggctt ggatgtgcga cctgtgggtc acgatctaag cacccgggat cgcatctttc 1141 ccgccgcgga tccctcctct gtggtggtca aatccctgct ggcctccgtg ggccatcggc 1201 tggccgtgcc caagccccgc gtggccattg tgtccacggg cagtgagcta ctctcgccgc 1261 gcgatcaacc gacgccgggc aagatcttcg actcgaatac caccatgctg gcggaactgc 1321 tgctctactt tggcttcgac tgcctgcaca cgagtgtgct gagcgacagc ttcgcgcaga 1381 cccgggaatc cctttccgat ctcttcgagg tggtggactt tgtcatctgc agcggcggcg 1441 tgtcgatggg cgacaaggat ttcgtgaagc ccgtgctgga ggacctgcag ttcaagcttc 1501 actgcggccg ggtgaacatg aagccaggca aacccatgac ctttgccagc cgcaacgaga 1561 agtacttctt cgggctgccc ggcaatcccg tgtccgcctt cgtcaccttc cacctgttcg 1621 ccctgcccgc catccgctgg gcggctggct gggatcgcca gaagtgctcc ctgcccgtga 1681 tcaatgtgaa gttgctcaac gacctcagtt tggatggccg tccggaattc gttcgcgcct 1741 cggtgatttc caaatccgga gagctgtacg ccagcattaa tggcgaccag ataagcagcc 1801 gcctgcagag cattgtgggt gccgatgttt tggtcaacct gccggcaaga acctccgatc 1861 gtccaactgc aaaggctggt gaagttttcc ccgcctccgt gctgcgctac gactttatct 1921 ccaagtacga ataggaactg cccagacaaa ccaatccaga accaatcgaa tccagacatc 1981 agacaacaca atagattagc acaaagattt attttttcat atatcgcaac attacgtaca 2041 atgtccatca atcaacaccc ttagcagtgt gtaaaaaaac gagtataaag taaatattat 2101 agaggccttc ctaaaggaag caatattatc gaacaaaaat aa