Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044393607 1179 bp mRNA linear INV 09-DEC-2024 13-related (Rpn13R), mRNA. ACCESSION XM_044393607 VERSION XM_044393607.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; corrected model. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044393607.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-627 JARPSC010000001.1 16704572-16705198 628-1179 JARPSC010000001.1 16705201-16705752 FEATURES Location/Qualifiers source 1..1179 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1179 /gene="Rpn13R" /note="Regulatory particle non-ATPase 13-related; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108059140" CDS 85..858 /gene="Rpn13R" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: proteasomal ubiquitin receptor ADRM1 homolog" /protein_id="XP_044249542.2" /db_xref="GeneID:108059140" /translation="MADSEAPNLVEYKVGRMTLLGKIVEPDERKGLLFVRRSAGDNQV HIHWMDRRSGAVELDILATPGDLEFRRIDQCKTGRVYVLKYTRSTQRYFFWMQEPQAE RDADFCQRINELIASGPRKYDESAAAEGDVDTDVEGDRTQHRGFGGSENHPAIEEVRQ VLEEEVAPAPLAFQDPDAEIFLGSSFTNYETQIILNHLRAPQFYESLSYFSLGLQSGV LGSILQPQDHHREALLNAAQAGDIERFLRVLHRNEGPTD" misc_feature 112..429 /gene="Rpn13R" /note="Pleckstrin homology-like domain of Regulatory Particle Non-ATPase 13; Region: PH_Rpn13; cd13314" /db_xref="CDD:270124" misc_feature order(202..207,211..213,262..285,337..345,352..354) /gene="Rpn13R" /note="ubiquitin binding site [polypeptide binding]; other site" /db_xref="CDD:270124" misc_feature <658..831 /gene="Rpn13R" /note="UCH-binding domain; Region: RPN13_C; pfam16550" /db_xref="CDD:465170" polyA_site 1179 /gene="Rpn13R" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagtaggcag ttgagaatgt attaaatcta caaatcgaag ctccggtaat tgcttcaaaa 61 ttcccagtac ccccatatat ctatatggcc gattcggagg cccccaattt ggtcgagtac 121 aaggtcggcc gcatgaccct cctgggcaaa atagtcgagc ccgatgagcg caagggcctg 181 ctctttgtgc gccgatccgc cggtgataac caggtgcaca tccactggat ggaccggcga 241 tccggggccg ttgagttgga cattcttgcc acgccgggcg accttgagtt ccgccgcatc 301 gatcaatgca aaacgggtcg ggtatatgtc ctcaagtaca cacgatccac gcagcgttac 361 ttcttctgga tgcaagagcc gcaggcggaa agggatgcgg acttttgcca gcggatcaac 421 gaacttatag ccagcggccc aaggaaatac gatgagagtg cggcggccga aggagatgtc 481 gatacggatg tggaagggga tcgaacccag caccgtggtt tcggtggcag tgagaatcat 541 ccggctatcg aggaagtgcg tcaagtccta gaagaagaag ttgctcctgc tcccctggca 601 tttcaagatc ccgatgcgga gatattctta ggcagcagtt ttaccaatta tgaaacgcag 661 ataattttga accatttgcg tgccccacaa ttctacgaaa gcctgtccta cttttcccta 721 ggcctccaat cgggggtctt gggttcgatc ctgcaaccac aggaccacca tcgtgaagcc 781 ctcttgaatg ctgcccaagc aggggatatc gagcgctttc tacgtgtcct gcatcgaaac 841 gaaggtccaa ccgattgagc cggagtgtct cataaataag tcaaaataca gagaaataaa 901 tatgagtata ctatatagta ccataaaaaa aaacataaca taaaaaaaaa caacaaaaaa 961 ttagaaaaaa gcgtacaaaa tgcaataact gcttcttcag tcctccttgg cccgtcgcct 1021 cgcttcgagt tacgaagata aatgagatgc cataagttag acgacaactt gcacaactcc 1081 agacaaagac caagcggata aaagtgtgct tggaaaaggc aaaaaaaagg cacactaaaa 1141 attgatataa aatacacaaa ataaaagaaa aaaaaagaa