Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Regulatory particle non-ATPase


LOCUS       XM_044393607            1179 bp    mRNA    linear   INV 09-DEC-2024
            13-related (Rpn13R), mRNA.
ACCESSION   XM_044393607
VERSION     XM_044393607.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044393607.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-627               JARPSC010000001.1  16704572-16705198
            628-1179            JARPSC010000001.1  16705201-16705752
FEATURES             Location/Qualifiers
     source          1..1179
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1179
                     /gene="Rpn13R"
                     /note="Regulatory particle non-ATPase 13-related; The
                     sequence of the model RefSeq transcript was modified
                     relative to its source genomic sequence to represent the
                     inferred CDS: deleted 2 bases in 1 codon; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108059140"
     CDS             85..858
                     /gene="Rpn13R"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 2 bases in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: proteasomal ubiquitin
                     receptor ADRM1 homolog"
                     /protein_id="XP_044249542.2"
                     /db_xref="GeneID:108059140"
                     /translation="MADSEAPNLVEYKVGRMTLLGKIVEPDERKGLLFVRRSAGDNQV
                     HIHWMDRRSGAVELDILATPGDLEFRRIDQCKTGRVYVLKYTRSTQRYFFWMQEPQAE
                     RDADFCQRINELIASGPRKYDESAAAEGDVDTDVEGDRTQHRGFGGSENHPAIEEVRQ
                     VLEEEVAPAPLAFQDPDAEIFLGSSFTNYETQIILNHLRAPQFYESLSYFSLGLQSGV
                     LGSILQPQDHHREALLNAAQAGDIERFLRVLHRNEGPTD"
     misc_feature    112..429
                     /gene="Rpn13R"
                     /note="Pleckstrin homology-like domain of Regulatory
                     Particle Non-ATPase 13; Region: PH_Rpn13; cd13314"
                     /db_xref="CDD:270124"
     misc_feature    order(202..207,211..213,262..285,337..345,352..354)
                     /gene="Rpn13R"
                     /note="ubiquitin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:270124"
     misc_feature    <658..831
                     /gene="Rpn13R"
                     /note="UCH-binding domain; Region: RPN13_C; pfam16550"
                     /db_xref="CDD:465170"
     polyA_site      1179
                     /gene="Rpn13R"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagtaggcag ttgagaatgt attaaatcta caaatcgaag ctccggtaat tgcttcaaaa
       61 ttcccagtac ccccatatat ctatatggcc gattcggagg cccccaattt ggtcgagtac
      121 aaggtcggcc gcatgaccct cctgggcaaa atagtcgagc ccgatgagcg caagggcctg
      181 ctctttgtgc gccgatccgc cggtgataac caggtgcaca tccactggat ggaccggcga
      241 tccggggccg ttgagttgga cattcttgcc acgccgggcg accttgagtt ccgccgcatc
      301 gatcaatgca aaacgggtcg ggtatatgtc ctcaagtaca cacgatccac gcagcgttac
      361 ttcttctgga tgcaagagcc gcaggcggaa agggatgcgg acttttgcca gcggatcaac
      421 gaacttatag ccagcggccc aaggaaatac gatgagagtg cggcggccga aggagatgtc
      481 gatacggatg tggaagggga tcgaacccag caccgtggtt tcggtggcag tgagaatcat
      541 ccggctatcg aggaagtgcg tcaagtccta gaagaagaag ttgctcctgc tcccctggca
      601 tttcaagatc ccgatgcgga gatattctta ggcagcagtt ttaccaatta tgaaacgcag
      661 ataattttga accatttgcg tgccccacaa ttctacgaaa gcctgtccta cttttcccta
      721 ggcctccaat cgggggtctt gggttcgatc ctgcaaccac aggaccacca tcgtgaagcc
      781 ctcttgaatg ctgcccaagc aggggatatc gagcgctttc tacgtgtcct gcatcgaaac
      841 gaaggtccaa ccgattgagc cggagtgtct cataaataag tcaaaataca gagaaataaa
      901 tatgagtata ctatatagta ccataaaaaa aaacataaca taaaaaaaaa caacaaaaaa
      961 ttagaaaaaa gcgtacaaaa tgcaataact gcttcttcag tcctccttgg cccgtcgcct
     1021 cgcttcgagt tacgaagata aatgagatgc cataagttag acgacaactt gcacaactcc
     1081 agacaaagac caagcggata aaagtgtgct tggaaaaggc aaaaaaaagg cacactaaaa
     1141 attgatataa aatacacaaa ataaaagaaa aaaaaagaa