Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044393513             692 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108063996), mRNA.
ACCESSION   XM_044393513
VERSION     XM_044393513.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044393513.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..692
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..692
                     /gene="LOC108063996"
                     /note="uncharacterized LOC108063996; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108063996"
     CDS             41..652
                     /gene="LOC108063996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044249448.2"
                     /db_xref="GeneID:108063996"
                     /translation="MKVFVCLLASLALASAGGFRGGAGGGYLPGGGRGGGGFGGRPAI
                     GAGLVSHVSQSQGNTKVHIGGGAASGGGAYGGGAAAYGGGAGASYGGGAASYGGGAGG
                     AAYGGGRGAGGWQGAGAGRGGGAGGAGGWQGGAGGAGGAGGNAWGNPAQFDYTVNHAS
                     GGGGGAGGAYGAGGAGGAAYGAAGGAGAGYGGGSRGGAGWWND"
ORIGIN      
        1 ttcgatcaga atctcaaatc caatcaactt cgattccaga atgaaggtct ttgtctgctt
       61 gttggcttcc ctggctctgg ccagtgccgg tggcttccgc ggtggtgccg gcggtggcta
      121 tctgcccggc ggaggacgcg gcggcggcgg cttcggtggt cgtccggcca ttggagcggg
      181 tctggtgtcc cacgtctccc agtcgcaggg caacactaag gtccacatcg gcggtggtgc
      241 cgctagcggc ggtggagcct acggcggtgg tgctgccgcc tatggcggtg gagcaggagc
      301 ttcctacggc ggtggtgcag cctcctatgg cggcggagct ggaggagctg cctatggcgg
      361 tggacgcggt gctggaggct ggcaaggagc tggagccgga cgcggtggtg gtgccggagg
      421 agctggaggc tggcagggtg gtgccggagg agctggtgga gctggaggca acgcctgggg
      481 caatcccgcc cagttcgatt acaccgtgaa ccacgcttcc ggcggcggtg gtggagcagg
      541 aggtgcctat ggagctggtg gtgccggtgg agctgcctat ggtgctgctg gtggagcagg
      601 agctggctac ggtggtggct cccgcggcgg tgctggctgg tggaacgatt aaacaatggc
      661 ttcttcaata taattgtaac ccaataagtg ca