Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_044393342 373 bp mRNA linear INV 09-DEC-2024 (LOC123002742), mRNA. ACCESSION XM_044393342 VERSION XM_044393342.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_044393342.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..373 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..373 /gene="LOC123002742" /note="uncharacterized LOC123002742; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:123002742" CDS 1..123 /gene="LOC123002742" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_044249277.1" /db_xref="GeneID:123002742" /translation="MTEEITGDWSYYVYISLTLVPVYLAFRLIKSLGWQLFVNN" ORIGIN 1 atgacggagg aaataaccgg cgattggagc tattacgtgt atatatcgct gacgttggtt 61 ccagtctatt tggcatttcg gctcattaag tcactgggct ggcagctctt cgtcaacaac 121 tgagcaaaca tctgaagctg aagctgaaac tgaactgaac tgaagttgca gccgtcatca 181 ggagggagac gagaaatccg tcgaggaaaa gtcgaacagc caaagccgaa gagcgtgata 241 tcaatgtgta tatattttgt aaaaatgcaa taaatggaaa gctaaaggac tagaaagcgg 301 cagaggagag agtgataaac aggggtccca gcagctgcca ggactgccag gattgccaga 361 atcgtgttgt gcg