Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_044393342             373 bp    mRNA    linear   INV 09-DEC-2024
            (LOC123002742), mRNA.
ACCESSION   XM_044393342
VERSION     XM_044393342.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_044393342.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..373
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..373
                     /gene="LOC123002742"
                     /note="uncharacterized LOC123002742; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:123002742"
     CDS             1..123
                     /gene="LOC123002742"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_044249277.1"
                     /db_xref="GeneID:123002742"
                     /translation="MTEEITGDWSYYVYISLTLVPVYLAFRLIKSLGWQLFVNN"
ORIGIN      
        1 atgacggagg aaataaccgg cgattggagc tattacgtgt atatatcgct gacgttggtt
       61 ccagtctatt tggcatttcg gctcattaag tcactgggct ggcagctctt cgtcaacaac
      121 tgagcaaaca tctgaagctg aagctgaaac tgaactgaac tgaagttgca gccgtcatca
      181 ggagggagac gagaaatccg tcgaggaaaa gtcgaacagc caaagccgaa gagcgtgata
      241 tcaatgtgta tatattttgt aaaaatgcaa taaatggaaa gctaaaggac tagaaagcgg
      301 cagaggagag agtgataaac aggggtccca gcagctgcca ggactgccag gattgccaga
      361 atcgtgttgt gcg