Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591992 938 bp mRNA linear INV 14-MAY-2021 (LOC111066337), transcript variant X2, mRNA. ACCESSION XM_041591992 VERSION XM_041591992.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..938 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..938 /gene="LOC111066337" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:111066337" CDS 642..911 /gene="LOC111066337" /codon_start=1 /product="uncharacterized protein LOC111066337 isoform X2" /protein_id="XP_041447926.1" /db_xref="GeneID:111066337" /translation="MREVKEAANTKRPEDGRQKGVVRTQIGVLCSCVRPKGPWTIGIF VAPSNAIKSNDLGHKPDVSMQNMYIFDYQKSNGEGNKKVWKMFSV" ORIGIN 1 atcctctaca atttcttctc atcgaatatc tttctaaacg cccttttttt tcgccgctgt 61 ccgctcctat ggccatccag ccttctcgct taagctctct gcttcggatt gctcctcacg 121 tccggatctc cgttgcatat tttcaatttt ttgcatttcc aacataaatt agccgtctcc 181 cagtgacccc caacacaaca ccgccccaca ggtccccctt ctcaagccgc tctccatcac 241 cggatttact ctccacatcc acagccacaa ccacgtccaa gtcttcctcc cttccttctc 301 cgcctgctcc tcccccttcc ggatcccggc cagaaataga catcggttag gacaagaaga 361 gcaagattcc tggcgtcaga aaagaacgtg gacacagggg gcaacaacaa aaaaaaaagt 421 gaagcgttaa taaaacggca caaaaggaaa caacaaataa acaacggcaa aaggcaaggc 481 aagactgggt ggagcggggc ggtgggggcg gtgtggggaa ggaggagtgt ggaggcgagc 541 ttggagtctg caaaaataat ggcaaaggtg taaccaaagt ccaggcccaa gatgatcatc 601 atcatgttga taataatgca aaagaacacg agaagaagcg aatgagagaa gtgaaggaag 661 cagcaaacac aaagcggccg gaggatgggc gccagaaggg agtggttcgg acgcagattg 721 gcgttctgtg ttcctgtgtt cggccaaagg gcccctggac tattggaatt ttcgtagctc 781 cttcgaatgc gatcaaatca aatgacttag gacacaaacc tgatgttagc atgcagaata 841 tgtatatatt cgactatcag aaatctaatg gggaaggcaa taaaaaggtt tggaaaatgt 901 tttcagttta aggaaaattt tctttaaaat aaacgaac