PREDICTED: Drosophila obscura xenotropic and polytropic retrovirus
LOCUS XM_041591989 2011 bp mRNA linear INV 14-MAY-2021
receptor 1 homolog (LOC111066266), mRNA.
ACCESSION XM_041591989
VERSION XM_041591989.1
DBLINK BioProject: PRJNA728747
KEYWORDS RefSeq; corrected model; includes ab initio.
SOURCE Drosophila obscura
ORGANISM Drosophila obscura
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_024542752.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Drosophila obscura Annotation
Release 101
Annotation Version :: 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.6
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 1% of CDS bases
frameshifts :: corrected 9 indels
internal stop codons :: corrected 1 genomic stop codons
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-7 JAECWW010000165.1 2739945-2739951
8-105 JAECWW010000165.1 2740134-2740231
106-141 JAECWW010000165.1 2740321-2740356
142-142 "N" 1-1
143-282 JAECWW010000165.1 2740357-2740496
283-284 "NN" 1-2
285-383 JAECWW010000165.1 2740497-2740595
384-483 JAECWW010000165.1 2740635-2740734
484-509 JAECWW010000165.1 2740736-2740761
510-855 JAECWW010000165.1 2740764-2741109
856-885 JAECWW010000165.1 2741111-2741140
886-1101 JAECWW010000165.1 2741142-2741357
1102-1102 "N" 1-1
1103-1255 JAECWW010000165.1 2741358-2741510
1256-1478 JAECWW010000165.1 2741561-2741783
1479-1512 JAECWW010000165.1 2741857-2741890
1513-1551 JAECWW010000165.1 2741893-2741931
1552-1552 "N" 1-1
1553-1633 JAECWW010000165.1 2741932-2742012
1634-2011 JAECWW010000165.1 2744065-2744442
FEATURES Location/Qualifiers
source 1..2011
/organism="Drosophila obscura"
/mol_type="mRNA"
/isolate="BZ-5 IFL"
/db_xref="taxon:7282"
/chromosome="Unknown"
/sex="male"
/tissue_type="whole fly"
/dev_stage="Adult fly"
/geo_loc_name="Serbia: Babin Zub"
/collection_date="2017"
gene 1..2011
/gene="LOC111066266"
/note="The sequence of the model RefSeq transcript was
modified relative to its source genomic sequence to
represent the inferred CDS: inserted 5 bases in 4 codons;
deleted 7 bases in 5 codons; Derived by automated
computational analysis using gene prediction method:
Gnomon. Supporting evidence includes similarity to: 2
Proteins, and 62% coverage of the annotated genomic
feature by RNAseq alignments"
/db_xref="GeneID:111066266"
CDS 1..1686
/gene="LOC111066266"
/note="The sequence of the model RefSeq protein was
modified relative to its source genomic sequence to
represent the inferred CDS: inserted 5 bases in 4 codons;
deleted 7 bases in 5 codons; substituted 1 base at 1
genomic stop codon"
/codon_start=1
/transl_except=(pos:1039..1041,aa:OTHER)
/product="LOW QUALITY PROTEIN: xenotropic and polytropic
retrovirus receptor 1 homolog"
/protein_id="XP_041447923.1"
/db_xref="GeneID:111066266"
/translation="METGTASCAACGAKAPQTFETHLTIEWRQQYLRYTALKAMIRQG
VDGXPHLGTASHKYGVESYYKAFEEAFCTECHNELDRVNNFFMEKLAEARXHATLKLQ
LLASARVPGHTSSAIALNSQRTAAADRKLMTQRQLRTVYSEFYLSLVLLQNFQSLNET
GSFRKICKKYQVSGVQLRRGLVRAAHSAGKPFGHYEPVPGGPFTWVIFNFFMAANVTG
WQRSGVNHVLIFDMDPRSHLQPATFLEIACTLGILWTLSMLGYLCHVPLHPLALILIM
LLLLLLVIPLPIMNWPARWTLARWTMRLMTAPLHYVGFADFWMGDQLNSLLTCLVDHY
YIVRFYTTCWLRXGAVPPYLTTDLMVPFMRCLPXLRRFRDSGSKSVTYLLNAGKYSTT
FCVVLFSTLRNRTDGTSLVPHRFPLTYGSMAASIVSTVYCYLWDVIKDFGLFRIRKGE
SAVLLLLNLLLRCFWVIEFTFYCHNLMTPHKARALASLLEITRRFIWNYVRLENGEYL
YNCGKFRATXDLAALKPRQERRLEDMMDESDRVTNRKRGSERERLGQQEKGRE"
misc_feature 40..510
/gene="LOC111066266"
/note="SPX domain of the xenotropic and polytropic
retrovirus receptor 1 (XPR1) and related proteins; Region:
SPX_XPR1_like; cd14477"
/db_xref="CDD:269898"
misc_feature 598..1524
/gene="LOC111066266"
/note="EXS family; Region: EXS; pfam03124"
/db_xref="CDD:460816"
ORIGIN
1 atggaaactg ggacggcttc ctgcgccgct tgtggggcaa aagcccccca aacctttgag
61 acgcatctga ccatcgaatg gcgacagcag tacctgcgat atacggctct gaaggcaatg
121 atcaggcagg gtgtggacgg tnggccgcat ctcggaaccg catcgcacaa atacggcgtc
181 gagagctact acaaggcctt cgaggaggcc ttctgcaccg agtgccacaa cgagctggat
241 cgcgtcaaca acttcttcat ggagaagctg gcggaggcgc gtnngcatgc caccctcaag
301 ctgcagctgc tggcatccgc ccgggtgccc gggcatacgt ccagtgccat agcgctgaac
361 tcacagcgaa cagcggcggc ggaccgtaag ttgatgaccc agcggcagct gcgcaccgtc
421 tacagcgagt tctacctcag cctggtgctg ctccagaatt ttcagtcgct caacgagacg
481 ggcagcttcc gcaagatctg taagaagtac caagtatctg gagtccaact ccggcgcgga
541 ctggttcgag cggcacatag cgcaggcaaa ccttttggcc attatgagcc tgtaccgggg
601 ggacccttca cctgggtcat cttcaacttc tttatggccg ccaatgtgac ggggtggcag
661 cggtcgggcg tcaaccatgt gctgatattc gacatggatc cgcgcagcca cctgcagccg
721 gccaccttcc tggagatcgc ctgcaccctc ggcatactgt ggacgctctc gatgctgggc
781 tacctctgcc atgtaccgct gcatccgctg gccctgatcc tcatcatgct gctgctgctg
841 ctgctggtga taccgctgcc gatcatgaac tggccggcac gctggacgct ggcacgctgg
901 acgatgcgac tgatgactgc gccgctgcac tacgtgggct tcgccgactt ctggatgggc
961 gatcagctga actcgctgct cacctgcctc gtcgatcact actacattgt gcgcttctac
1021 accacctgct ggctgcggta gggggcggtg ccgccgtacc tcaccaccga tctgatggtg
1081 ccgttcatgc gctgcctgcc cngcctgcgc cgattccggg acagcggctc caagtccgtc
1141 acctatctgc tcaatgccgg gaagtactcg acgacattct gcgtggtgct cttctccacg
1201 ctgcgcaatc gaacggatgg tacgagcctc gtcccccacc ggttcccact cacatacgga
1261 tctatggccg cctccatagt gtccaccgtg tactgctatt tgtgggacgt gatcaaggac
1321 tttggcctgt tccgcatccg caagggggag tccgcagtcc ttctactgct gaatctgctg
1381 ctgcgctgct tctgggtgat cgagttcacg ttctactgcc acaacctgat gacgccccac
1441 aaggccagag ctctggccag tctcctggag atcacgcggc gcttcatctg gaactacgtg
1501 cgattggaga atggagagta tctgtacaac tgcggcaagt ttcgtgccac antcgatctg
1561 gcggcgctca agccgcggca ggagcgcagg ctcgaggaca tgatggacga gtcggacagg
1621 gtgaccaatc gcaagagggg cagcgaaaga gagaggctag gacagcagga gaaaggcaga
1681 gaatgagcct gttgctatta ttaattgccg ctgccatcga tgctgctgct gctgctgctg
1741 ctgctgctgt gtcaattaag ctgcaacatg agtcgagtgc agtgcaatat gcggcggctc
1801 catgtcctct gtccgcagat tgtggccgat gtggccgatc ttggtacagt tgcacacgcg
1861 ccaaaaccag accaaataga caaaaacaag caaacaacaa aaaggcgaag cgaaaaagca
1921 aacaagcaaa gcgaagaaca gcccagtgga gggagcccaa cccaagccaa gtcgaatgaa
1981 caaacaaaca aacaaatccc aatacgatac c