Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591989 2011 bp mRNA linear INV 14-MAY-2021 receptor 1 homolog (LOC111066266), mRNA. ACCESSION XM_041591989 VERSION XM_041591989.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; corrected model; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases frameshifts :: corrected 9 indels internal stop codons :: corrected 1 genomic stop codons ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 JAECWW010000165.1 2739945-2739951 8-105 JAECWW010000165.1 2740134-2740231 106-141 JAECWW010000165.1 2740321-2740356 142-142 "N" 1-1 143-282 JAECWW010000165.1 2740357-2740496 283-284 "NN" 1-2 285-383 JAECWW010000165.1 2740497-2740595 384-483 JAECWW010000165.1 2740635-2740734 484-509 JAECWW010000165.1 2740736-2740761 510-855 JAECWW010000165.1 2740764-2741109 856-885 JAECWW010000165.1 2741111-2741140 886-1101 JAECWW010000165.1 2741142-2741357 1102-1102 "N" 1-1 1103-1255 JAECWW010000165.1 2741358-2741510 1256-1478 JAECWW010000165.1 2741561-2741783 1479-1512 JAECWW010000165.1 2741857-2741890 1513-1551 JAECWW010000165.1 2741893-2741931 1552-1552 "N" 1-1 1553-1633 JAECWW010000165.1 2741932-2742012 1634-2011 JAECWW010000165.1 2744065-2744442 FEATURES Location/Qualifiers source 1..2011 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..2011 /gene="LOC111066266" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: inserted 5 bases in 4 codons; deleted 7 bases in 5 codons; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 62% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066266" CDS 1..1686 /gene="LOC111066266" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 5 bases in 4 codons; deleted 7 bases in 5 codons; substituted 1 base at 1 genomic stop codon" /codon_start=1 /transl_except=(pos:1039..1041,aa:OTHER) /product="LOW QUALITY PROTEIN: xenotropic and polytropic retrovirus receptor 1 homolog" /protein_id="XP_041447923.1" /db_xref="GeneID:111066266" /translation="METGTASCAACGAKAPQTFETHLTIEWRQQYLRYTALKAMIRQG VDGXPHLGTASHKYGVESYYKAFEEAFCTECHNELDRVNNFFMEKLAEARXHATLKLQ LLASARVPGHTSSAIALNSQRTAAADRKLMTQRQLRTVYSEFYLSLVLLQNFQSLNET GSFRKICKKYQVSGVQLRRGLVRAAHSAGKPFGHYEPVPGGPFTWVIFNFFMAANVTG WQRSGVNHVLIFDMDPRSHLQPATFLEIACTLGILWTLSMLGYLCHVPLHPLALILIM LLLLLLVIPLPIMNWPARWTLARWTMRLMTAPLHYVGFADFWMGDQLNSLLTCLVDHY YIVRFYTTCWLRXGAVPPYLTTDLMVPFMRCLPXLRRFRDSGSKSVTYLLNAGKYSTT FCVVLFSTLRNRTDGTSLVPHRFPLTYGSMAASIVSTVYCYLWDVIKDFGLFRIRKGE SAVLLLLNLLLRCFWVIEFTFYCHNLMTPHKARALASLLEITRRFIWNYVRLENGEYL YNCGKFRATXDLAALKPRQERRLEDMMDESDRVTNRKRGSERERLGQQEKGRE" misc_feature 40..510 /gene="LOC111066266" /note="SPX domain of the xenotropic and polytropic retrovirus receptor 1 (XPR1) and related proteins; Region: SPX_XPR1_like; cd14477" /db_xref="CDD:269898" misc_feature 598..1524 /gene="LOC111066266" /note="EXS family; Region: EXS; pfam03124" /db_xref="CDD:460816" ORIGIN 1 atggaaactg ggacggcttc ctgcgccgct tgtggggcaa aagcccccca aacctttgag 61 acgcatctga ccatcgaatg gcgacagcag tacctgcgat atacggctct gaaggcaatg 121 atcaggcagg gtgtggacgg tnggccgcat ctcggaaccg catcgcacaa atacggcgtc 181 gagagctact acaaggcctt cgaggaggcc ttctgcaccg agtgccacaa cgagctggat 241 cgcgtcaaca acttcttcat ggagaagctg gcggaggcgc gtnngcatgc caccctcaag 301 ctgcagctgc tggcatccgc ccgggtgccc gggcatacgt ccagtgccat agcgctgaac 361 tcacagcgaa cagcggcggc ggaccgtaag ttgatgaccc agcggcagct gcgcaccgtc 421 tacagcgagt tctacctcag cctggtgctg ctccagaatt ttcagtcgct caacgagacg 481 ggcagcttcc gcaagatctg taagaagtac caagtatctg gagtccaact ccggcgcgga 541 ctggttcgag cggcacatag cgcaggcaaa ccttttggcc attatgagcc tgtaccgggg 601 ggacccttca cctgggtcat cttcaacttc tttatggccg ccaatgtgac ggggtggcag 661 cggtcgggcg tcaaccatgt gctgatattc gacatggatc cgcgcagcca cctgcagccg 721 gccaccttcc tggagatcgc ctgcaccctc ggcatactgt ggacgctctc gatgctgggc 781 tacctctgcc atgtaccgct gcatccgctg gccctgatcc tcatcatgct gctgctgctg 841 ctgctggtga taccgctgcc gatcatgaac tggccggcac gctggacgct ggcacgctgg 901 acgatgcgac tgatgactgc gccgctgcac tacgtgggct tcgccgactt ctggatgggc 961 gatcagctga actcgctgct cacctgcctc gtcgatcact actacattgt gcgcttctac 1021 accacctgct ggctgcggta gggggcggtg ccgccgtacc tcaccaccga tctgatggtg 1081 ccgttcatgc gctgcctgcc cngcctgcgc cgattccggg acagcggctc caagtccgtc 1141 acctatctgc tcaatgccgg gaagtactcg acgacattct gcgtggtgct cttctccacg 1201 ctgcgcaatc gaacggatgg tacgagcctc gtcccccacc ggttcccact cacatacgga 1261 tctatggccg cctccatagt gtccaccgtg tactgctatt tgtgggacgt gatcaaggac 1321 tttggcctgt tccgcatccg caagggggag tccgcagtcc ttctactgct gaatctgctg 1381 ctgcgctgct tctgggtgat cgagttcacg ttctactgcc acaacctgat gacgccccac 1441 aaggccagag ctctggccag tctcctggag atcacgcggc gcttcatctg gaactacgtg 1501 cgattggaga atggagagta tctgtacaac tgcggcaagt ttcgtgccac antcgatctg 1561 gcggcgctca agccgcggca ggagcgcagg ctcgaggaca tgatggacga gtcggacagg 1621 gtgaccaatc gcaagagggg cagcgaaaga gagaggctag gacagcagga gaaaggcaga 1681 gaatgagcct gttgctatta ttaattgccg ctgccatcga tgctgctgct gctgctgctg 1741 ctgctgctgt gtcaattaag ctgcaacatg agtcgagtgc agtgcaatat gcggcggctc 1801 catgtcctct gtccgcagat tgtggccgat gtggccgatc ttggtacagt tgcacacgcg 1861 ccaaaaccag accaaataga caaaaacaag caaacaacaa aaaggcgaag cgaaaaagca 1921 aacaagcaaa gcgaagaaca gcccagtgga gggagcccaa cccaagccaa gtcgaatgaa 1981 caaacaaaca aacaaatccc aatacgatac c