Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591988 537 bp mRNA linear INV 14-MAY-2021 1-like (LOC111066329), mRNA. ACCESSION XM_041591988 VERSION XM_041591988.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..537 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..537 /gene="LOC111066329" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 22 Proteins" /db_xref="GeneID:111066329" CDS 1..537 /gene="LOC111066329" /codon_start=1 /product="CTD nuclear envelope phosphatase 1-like" /protein_id="XP_041447922.1" /db_xref="GeneID:111066329" /translation="MANKKTVILNLLTLVKVVVVRSTDALCENHGLPYDWVFDLPEYY AKVYVYKRPHLDFFIKKIYAWCHLIVFTTSDRVWTPLVLDYLDGGQNVLNKRLDGSDY NRGLGFDHLSLAYNDLTGKILLAHTNQISADNKDNTIPIDDYVIGAWDQKLLTLLPII DSLRFVEDVRSILRRYRR" misc_feature 91..504 /gene="LOC111066329" /note="The haloacid dehalogenase (HAD) superfamily includes carbon and phosphorus hydrolases such as 2-haloalkonoate dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, among others. These...; Region: Haloacid Dehalogenase-like Hydrolases; cl21460" /db_xref="CDD:473868" ORIGIN 1 atggcgaata agaagacagt gattctgaat ctattgactt tggtgaaagt ggtggtggtg 61 cggtcaacag atgcactgtg cgagaatcat ggtttgccct atgattgggt gttcgattta 121 cccgaatact atgccaaagt ctatgtctac aagcgtcccc atctggattt ttttatcaag 181 aaaatctatg cgtggtgcca tctgatcgtg ttcaccactt cagatagggt gtggactccg 241 cttgtgctcg actatttgga tggtggacag aatgtgctca ataaacgctt ggacggcagc 301 gactacaatc gtggactcgg ctttgatcac ctttcgctag cttataacga tctgaccggc 361 aaaattctgc tggctcatac caaccagatt tccgctgaca ataaggacaa taccatacca 421 atcgatgact atgtcatcgg tgcctgggac cagaagctgc tcactctgct gccaataatc 481 gattctcttc gctttgtcga ggatgtgcgt tcaatcttga ggcgttaccg gcgttga