Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591985 774 bp mRNA linear INV 14-MAY-2021 protein 410-like (LOC121403889), mRNA. ACCESSION XM_041591985 VERSION XM_041591985.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..774 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..774 /gene="LOC121403889" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:121403889" CDS 1..774 /gene="LOC121403889" /codon_start=1 /product="cilia- and flagella-associated protein 410-like" /protein_id="XP_041447919.1" /db_xref="GeneID:121403889" /translation="MTVLLEQMVLYLAKVHDVERVVNISFVNCGLTDVSIVQRMAKLE IASLSVNGITSLKVFAGCTMLKKLYLRSNKIEDINEVEHIRNLLHLEDFTLEGNPCVK RAGPGYRGILLRTLRTLKIIDTTQVTGEEVRNALWNSNPPVMHDEHNEESLNPFDAYH QSAQQMSCSASPQVEQLVQVSPRPRRPFTAGQQEQELSPDPPGTPSMGAALRLTLALA ETSPVRTTVKWAQQTRRPARPCSLCATTDARRWTLAETS" misc_feature <127..384 /gene="LOC121403889" /note="protein phosphatase 1 regulatory subunit 42; Region: PPP1R42; cl42388" /db_xref="CDD:455733" misc_feature 127..192 /gene="LOC121403889" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275378" misc_feature 193..267 /gene="LOC121403889" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275378" ORIGIN 1 atgacggtgc tactggaaca aatggttttg tacctggcca aggtccatga tgtggagaga 61 gttgtgaata ttagctttgt caactgtggc ctgacggacg tttcgatagt acagcgtatg 121 gccaaattgg agatagcttc actctcagtt aatgggatca catcattgaa ggtatttgct 181 ggctgcacta tgctgaagaa gctatatctg cgatcaaata agattgagga catcaatgag 241 gtggagcata tcaggaactt gcttcatctc gaagatttca ccttagaggg taacccgtgc 301 gtgaaaagag ctggtccagg gtatcgcgga atactgctgc gcactctgcg aacgctgaaa 361 ataatagata ccactcaagt aactggtgag gaggtcagaa atgcattgtg gaacagcaac 421 cctcctgtca tgcatgacga acataatgaa gaatccttga atccttttga cgcatatcat 481 cagtcagctc aacagatgag ctgcagcgcg agtcctcagg tggaacagtt ggtacaggtg 541 tcaccgcgtc ctaggaggcc attcacagcc ggacagcagg agcaggaact atcaccagac 601 cccccaggca ctccctcaat gggagctgct ctccggttga ctcttgcttt ggcagaaaca 661 tctcccgtga gaactaccgt caaatgggcc cagcagacaa ggcgcccagc gcgtccgtgc 721 agcctgtgcg cgactacaga tgccaggcgt tggaccttgg ccgaaacttc atag