Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura cilia- and flagella-associated


LOCUS       XM_041591985             774 bp    mRNA    linear   INV 14-MAY-2021
            protein 410-like (LOC121403889), mRNA.
ACCESSION   XM_041591985
VERSION     XM_041591985.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..774
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..774
                     /gene="LOC121403889"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins"
                     /db_xref="GeneID:121403889"
     CDS             1..774
                     /gene="LOC121403889"
                     /codon_start=1
                     /product="cilia- and flagella-associated protein 410-like"
                     /protein_id="XP_041447919.1"
                     /db_xref="GeneID:121403889"
                     /translation="MTVLLEQMVLYLAKVHDVERVVNISFVNCGLTDVSIVQRMAKLE
                     IASLSVNGITSLKVFAGCTMLKKLYLRSNKIEDINEVEHIRNLLHLEDFTLEGNPCVK
                     RAGPGYRGILLRTLRTLKIIDTTQVTGEEVRNALWNSNPPVMHDEHNEESLNPFDAYH
                     QSAQQMSCSASPQVEQLVQVSPRPRRPFTAGQQEQELSPDPPGTPSMGAALRLTLALA
                     ETSPVRTTVKWAQQTRRPARPCSLCATTDARRWTLAETS"
     misc_feature    <127..384
                     /gene="LOC121403889"
                     /note="protein phosphatase 1 regulatory subunit 42;
                     Region: PPP1R42; cl42388"
                     /db_xref="CDD:455733"
     misc_feature    127..192
                     /gene="LOC121403889"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    193..267
                     /gene="LOC121403889"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
ORIGIN      
        1 atgacggtgc tactggaaca aatggttttg tacctggcca aggtccatga tgtggagaga
       61 gttgtgaata ttagctttgt caactgtggc ctgacggacg tttcgatagt acagcgtatg
      121 gccaaattgg agatagcttc actctcagtt aatgggatca catcattgaa ggtatttgct
      181 ggctgcacta tgctgaagaa gctatatctg cgatcaaata agattgagga catcaatgag
      241 gtggagcata tcaggaactt gcttcatctc gaagatttca ccttagaggg taacccgtgc
      301 gtgaaaagag ctggtccagg gtatcgcgga atactgctgc gcactctgcg aacgctgaaa
      361 ataatagata ccactcaagt aactggtgag gaggtcagaa atgcattgtg gaacagcaac
      421 cctcctgtca tgcatgacga acataatgaa gaatccttga atccttttga cgcatatcat
      481 cagtcagctc aacagatgag ctgcagcgcg agtcctcagg tggaacagtt ggtacaggtg
      541 tcaccgcgtc ctaggaggcc attcacagcc ggacagcagg agcaggaact atcaccagac
      601 cccccaggca ctccctcaat gggagctgct ctccggttga ctcttgcttt ggcagaaaca
      661 tctcccgtga gaactaccgt caaatgggcc cagcagacaa ggcgcccagc gcgtccgtgc
      721 agcctgtgcg cgactacaga tgccaggcgt tggaccttgg ccgaaacttc atag