Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_041591984 501 bp mRNA linear INV 14-MAY-2021 (LOC111066367), mRNA. ACCESSION XM_041591984 VERSION XM_041591984.1 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..501 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..501 /gene="LOC111066367" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:111066367" CDS 1..501 /gene="LOC111066367" /codon_start=1 /product="uncharacterized protein LOC111066367" /protein_id="XP_041447918.1" /db_xref="GeneID:111066367" /translation="MTVYLSNYVGVWGEASDSERLLKRVSEPVNLMIKSMSSTEALSW HADDIFNRSVKKSFNFIGHLPEHISDAIDGAKVACTIMSKEAKLANQEMASIFRNLSH VEMMRFLEMLELRPISKDSLYSEGSIKKAEEKQRLEADEEATAGLKQQAKDEAEAEAG AEEAKQ" misc_feature 28..213 /gene="LOC111066367" /note="MICOS complex subunit MIC13, QIL1; Region: QIL1; pfam15884" /db_xref="CDD:464923" ORIGIN 1 atgacagttt acctcagcaa ttacgttggt gtctggggcg aggcttcgga ttccgaacgc 61 ctgctcaagc gcgtcagtga gcccgtcaac ctcatgatca agtcgatgtc atcaacggag 121 gcactcagct ggcatgctga tgacatcttc aatcggagcg tcaagaagag ctttaatttc 181 attggtcatc tgcccgagca catctcggat gcaatcgatg gcgccaaagt ggcctgcacg 241 attatgagca aagaagccaa gctggccaat caggagatgg ccagcatctt ccgtaacttg 301 tcgcatgtgg aaatgatgcg atttttggaa atgttggagc tgcgtcccat ttccaaagac 361 tcgctttatt ctgagggttc aatcaagaaa gccgaagaga agcaacgtct ggaggcagac 421 gaggaagcga ccgcaggcct caagcagcag gccaaggatg aggcggaggc cgaggccggg 481 gcagaggagg cgaagcaata a