Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066367


LOCUS       XM_041591984             501 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066367), mRNA.
ACCESSION   XM_041591984
VERSION     XM_041591984.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..501
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..501
                     /gene="LOC111066367"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:111066367"
     CDS             1..501
                     /gene="LOC111066367"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066367"
                     /protein_id="XP_041447918.1"
                     /db_xref="GeneID:111066367"
                     /translation="MTVYLSNYVGVWGEASDSERLLKRVSEPVNLMIKSMSSTEALSW
                     HADDIFNRSVKKSFNFIGHLPEHISDAIDGAKVACTIMSKEAKLANQEMASIFRNLSH
                     VEMMRFLEMLELRPISKDSLYSEGSIKKAEEKQRLEADEEATAGLKQQAKDEAEAEAG
                     AEEAKQ"
     misc_feature    28..213
                     /gene="LOC111066367"
                     /note="MICOS complex subunit MIC13, QIL1; Region: QIL1;
                     pfam15884"
                     /db_xref="CDD:464923"
ORIGIN      
        1 atgacagttt acctcagcaa ttacgttggt gtctggggcg aggcttcgga ttccgaacgc
       61 ctgctcaagc gcgtcagtga gcccgtcaac ctcatgatca agtcgatgtc atcaacggag
      121 gcactcagct ggcatgctga tgacatcttc aatcggagcg tcaagaagag ctttaatttc
      181 attggtcatc tgcccgagca catctcggat gcaatcgatg gcgccaaagt ggcctgcacg
      241 attatgagca aagaagccaa gctggccaat caggagatgg ccagcatctt ccgtaacttg
      301 tcgcatgtgg aaatgatgcg atttttggaa atgttggagc tgcgtcccat ttccaaagac
      361 tcgctttatt ctgagggttc aatcaagaaa gccgaagaga agcaacgtct ggaggcagac
      421 gaggaagcga ccgcaggcct caagcagcag gccaaggatg aggcggaggc cgaggccggg
      481 gcagaggagg cgaagcaata a